Todos os Casos: D2018-1800 - D2018-1999

Ultima atualização: Jul 16, 2019

Número do Caso Nome(s) de Domínio Reclamante Reclamado(a) Data de Início Andamento
D2018-1800beymenyapi.comBeymen Maǧazacılık Anonim Şirketi--Arquivado
D2018-1801dunderfun.comDunder Limited--Arquivado
D2018-1802belfius.appBelfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkers-Decidido
D2018-1803easybreath.websiteProjectClubPrivacy Protection / Alesandr Pilschikov-Decidido
D2018-1804rockefellerqroup.comRockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Mills-Decidido
D2018-1805americanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla-Decidido
D2018-1806chatur2018.comMulti Media, LLCWhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasya-Decidido
D2018-1807buylinkedinfollowers.comLinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics-Decidido
D2018-1808asianet.netAsianet Satellite Communications LimitedFuture Media Architects Inc.-Decidido
D2018-1809goindigo.comInterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decidido
D2018-18101xbet.dateNavasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko -Decidido
D2018-1811cic-mon-compte.reviewCrédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexis-Decidido
D2018-1812tangfreres.onlineTang Frerestang freres-Decidido
D2018-1813afflelou3d.comAlain Afflelou Franchiseur--Arquivado
D2018-1814kikotechnology.comKiko Technology LimitedRobert Gibellini-Decidido
D2018-1815hidqlobal.comHID Global CorporationJohn Makinwa-Decidido
D2018-1816childrensoutlet.comChildrens Outlet LtdIan Davidson, Childrensalon Ltd-Decidido
D2018-1817arcelormittal.topArcelorMittal (SA)zhou zhou, zhou zhou-Decidido
D2018-1818creditmutuel.companyConfederation Nationale Du Credit MutuelDavid Leparoux-Decidido
D2018-1819mr-bricolage.onlineMr BricolageWhoisGuard, Inc. / Alexandre Noffy-Decidido
D2018-1820zanussi.online
zanussi.site
AB Electrolux--Arquivado
D2018-1821blephacleanse.comLaboratoires Thea--Arquivado
D2018-1822zanussi.clickAB ElectroluxRajaa Nasr-Decidido
D2018-1823zanussi.expertAB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.-Decidido
D2018-1824intercontinentalhotelaustin.comInter-Continental Hotels Corporationnibah perfect fondikum-Decidido
D2018-1825expensifysupport.comExpensify, Inc.--Arquivado
D2018-1826airvape.comRoland Szegi--Arquivado
D2018-1827oandaxmtrade.comOanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter-Decidido
D2018-1828buy-duromine.com
cheapduromine.com
iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.-Decidido
D2018-1829saphanatutorial.comSAP SESwarup Choudhuri-Decidido
D2018-1830allianz.travelAllianz SEInnokentiy Maskileyson-Decidido
D2018-1831brightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
The Brighton and Hove Albion Football Club LimitedMr. Dave Bantock-Decidido
D2018-1832boynerler.comBoyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boyners-Decidido
D2018-1833implantcast.comImplantcast GmbHBeats-Decidido
D2018-1834buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
-Decidido
D2018-1835higeen.comHouseholds & Toiletries Manufacturing Co. Ltd.Kawar, Fathi, El-Maydan Co. Oil Fields Supply-Decidido
D2018-1836buyduromineonline.com
duromineonline.com
iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescu-Decidido
D2018-1837nycifgroup.comNew York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.-Decidido
D2018-1838fdmag.comThe Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise -Decidido
D2018-1839lincolnnavigator.comFord Motor CompanyAdvert Online-Decidido
D2018-1840boycottbayer.comBayer AG--Arquivado
D2018-1841bayernow.comBayer AGRegistration Private, Domains By Proxy, LLC. / Elizabeth Hulbert-Decidido
D2018-1842bestiqos.comPhilip Morris Products S.A.Liudinghong-Decidido
D2018-1843tjarcelormittal.comArcelormittal S.A.--Arquivado
D2018-1844credit-mutuel.techConfederation Nationale du Credit MutuelMalo Corentine-Decidido
D2018-1845catindustrie.com
catmarbre.com
Caterpillar Inc.Sara Alaoui-Decidido
D2018-1846osramd.comOSRAM GmbHyue tang, tangyue-Decidido
D2018-1847proximus.techPROXIMUS, NV van publiek rechtWang Xiao Qin -Decidido
D2018-1848starstable-hack.winStar Stable Entertainment ABDawid Olszewski-Decidido
D2018-1849temaris.comTenaris Connections BVDomain Admin, HugeDomains.com-Decidido
D2018-1850fashionphileoutlet.comFashionphile, LLC--Arquivado
D2018-1851gerbentrademark.comGerben Law Firm, PLLCWhois Privacy Corp.-Decidido
D2018-1852buyduromineonline.comiNova Pharmaceuticals (Singapore) Pte. Limited--Arquivado
D2018-1853eternalfleur.comVenus et Fleur LLCDomains by Proxy, LLC / Amanda Wojtas-Decidido
D2018-1854ilbm.comInternational Business Machines Corporation--Arquivado
D2018-1855credit-mutuel-confirmation-mobile.comCaisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichant-Decidido
D2018-1856aex.com
aex-global.com
aex88.com
Euronext N.V.Huang tian wei-Decidido
D2018-1857elliotttmgmt.comElliott Management Corporation--Arquivado
D2018-1858gotmilkyet.comCalifornia Milk Processor BoardJeff Pendleton, Harvest Properties, LLC-Decidido
D2018-1859medium-airdrop.com
medium-news.com
A Medium CorporationProtection of Private Person / Yurii Selivanov -Decidido
D2018-1860mediurn.comA Medium CorporationMarat Mukhamet-Decidido
D2018-1861dreamstine.comDreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decidido
D2018-1862freetokenschaturbate.comMulti Media, LLCRegistration Private, Domains By Proxy, LLC / Apetre Andrei-Decidido
D2018-1863nmglego.comLEGO Juris A/S (乐高博士有限公司)Xu Yin Liang-Decidido
D2018-1864phillpmorris.comPhilip Morris USA Inc.--Arquivado
D2018-1865cbdhempmeds.netMedical Marijuana, Inc.Domains By Proxy, LLC / Michael Wigton-Decidido
D2018-1866divorcepaperswriter.comPro Se Planning, Inc. dba DivorcewriterRegistration Private, Domains By Proxy, LLC / Bogdanov Andriy-Decidido
D2018-1867unifi-ip.comUbiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolle-Decidido
D2018-1868iqos-plus.comPhilip Morris Products S.A.Kostas Martakis-Decidido
D2018-1869iqos456.comPhilip Morris Products S.A.Yang Jiang Nan-Decidido
D2018-1870mifare.shop
mifare.store
NXP B.V.Ershov Dmitrii-Decidido
D2018-1871mutuelcreditinvest.comConfederation Nationale du Credit MutuelGARR Garderie-Decidido
D2018-1872blackiqos.comPhilip Morris Products S.A.--Arquivado
D2018-1873iqosmy.net
iqosmy.org
Philip Morris Products S.A.Yuksel Kambal-Decidido
D2018-1874pmiukraine.orgProject Management Institute, Inc.Privacy Protect, LLC / Herr Thomas Henk-Decidido
D2018-1875valero.vipValero Energy Corporation
Valero Marketing and Supply Company
Lacey Larsen-Decidido
D2018-1876bartec.comBartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Brady-Decidido
D2018-1877newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
Artur Hasamov
Artur Hasamov, Private Person
Gustavo Frings
Moniker Privacy Services
moniker.com, Moniker Online Services, LLC
Oleksandr Nikolaienko
Protection of Private Person
-Decidido
D2018-1878fr-robertet.comRobertet SAMarie Claude Holler-Decidido
D2018-1879iqosturk.comPhilip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay-Decidido
D2018-1880allybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Ally Financial Inc.Zhao Hong-Decidido
D2018-1881capgroupco.com
thecapitalgroupco.com
The Capital Group Companies, Inc.Crystal Marie, Savoy Partners London
Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London
-Decidido
D2018-1882hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Project-Decidido
D2018-1883breitlingboutique.com
breitlingshop.com
breitlingstore.com
Breitling SAManoj Kumar Alwani-Decidido
D2018-1884dtccglobal.comThe Depository Trust & Clearing CorporationName Redacted-Decidido
D2018-1885pezo.comPezo Tech LLCPerfect Privacy, LLC / Mihalis Pourgouris-Decidido
D2018-1886accentureplacement.comAccenture Global Services LimitedDomain eRegistration-Decidido
D2018-1887spradleyford.comFord Motor CompanyWhois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Company-Decidido
D2018-1888chep-uk.com
chep-us.com
Brambles Ltd.WhoisGuard Protected / Emimimo Steven / avoca davis -Decidido
D2018-1889huntbrotherspizza.onlineHunt Family Properties, LLCLarry Lee, Phoenix Success Systems-Decidido
D2018-1890dreamstimes.comDreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decidido
D2018-1891mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Mou LimitedDomain Admin Privacy Protect, LLC (PrivacyProtect.org)
Luo Yuandong, Laoyuandong
Song Li Hong
Sun YanQi
Whois Agent, Domain Whois Privacy Protection Service
-Decidido
D2018-1892mandginvestment.comM&G LimitedSmith Taylor-Decidido
D2018-1893duobrii.comValeant Pharmaceuticals Ireland LimitedDomains By Proxy, LLC / Micro Duobri,New Micro Age-Decidido
D2018-1894halfordsgroup.comHalfords Limited--Arquivado
D2018-1895onewheel-hoverboard.comFuture Motion, Inc.Nexperian Holding Limited / Duke Chow, Duke-Decidido
D2018-1896socap2018.orgSocial Capital Markets LLCDomains By Proxy, LLC / victor gill-Decidido
D2018-1897secure-gap.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell -Decidido
D2018-1898bouygues-services.comBouyguesNom anonymisé-Decidido
D2018-1899dreamtimes.comDreamstime.com, LLCSapphire Brands, Sapphire Brands Limited-Decidido
D2018-1900breezula.com
winlevi.com
Cassiopea S.p.A.--Arquivado
D2018-1901erieicedamremovalguys.comPalumbo Services, Inc.kyle Brink, Brink Roofing-Decidido
D2018-1902lascal.comJoran LundhPRIVACYDOTLINK Customer 2898984 / Stanley Pace-Decidido
D2018-1903valero-usa.comValero Energy Corporation
Valero Marketing and Supply Company
Riaat Benn-Decidido
D2018-1904varta-automotlve.comJohnson Controls Hybrid and Recycling GmbHWang Jian Hua-Decidido
D2018-1905montar.comMontar A/SDomain Administrator, NameFind LLC-Decidido
D2018-1906bosch-ua.comRobert Bosch GmbHMaxim SPD CHervinchuk-Decidido
D2018-1907besteggloansreviews.comMarlette Funding, LLCWhois Privacy Corp-Decidido
D2018-1908gqme.comAdvance Magazine Publishers Inc.Robert McDonough-Decidido
D2018-1909tmf-gronp.comTMF Group B.V.Contact Privacy Inc. Customer 1242811003 / The Dovetail Agency-Decidido
D2018-1910jaegerdressessale.comKings Landing LimitedName Redacted-Decidido
D2018-1911virginluxuryhotels.comVirgin Enterprises LimitedZanta Consult-Decidido
D2018-1912decathlon-sa.comDecathlonBill Wang-Decidido
D2018-1913grouperexel.comRexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durand-Decidido
D2018-1914cic-admin.comCrédit industriel et commercial S.A.--Arquivado
D2018-1915lotoeuromillions.comS.L.E. Service aux Loteries en EuropeSuper Privacy Service Ltd. c/o Dynadot-Decidido
D2018-1916loto-euro-millions-jackpot.comS.L.E. Service aux Loteries en EuropeAlbert Rajala-Decidido
D2018-1917euromillions-lotto.netS.L.E. Service aux Loteries en EuropeSteve Patton, Data Download -Decidido
D2018-1918piombo.com82 s.r.l.Chris Grivas-Decidido
D2018-1919t20worldcup.comICC Business Corporation FZ LLCShashank Sharma-Decidido
D2018-1920foreverloveibm.comInternational Business Machines CorporationWhoisGuard Protected / Richard Anderson-Decidido
D2018-1921ibmmonitors.netInternational Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchange-Decidido
D2018-1922kraftheinzcornpany.comKraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltd-Decidido
D2018-1923lincolnnavigator.orgFord Motor CompanyCustomer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. -Decidido
D2018-1924legoland-danmark.comLEGO Juris A/SAdmin Contact, PrivateName Services Inc. / Rey Leande-Decidido
D2018-1925freywille.orgFrey Wille GmbH & Co. KGKabir S Rawat-Decidido
D2018-1926bancointer.appBanco Inter S.A.Anderson Santos, leaodechacara.com-Decidido
D2018-1927klarnabitcoin.comKlarna Bank AB--Arquivado
D2018-1928klarnascam.comKlarna Bank ABSuper Privacy Service LTD c/o Dynadot-Decidido
D2018-1929legoclone.comLEGO Juris A/SThai Dang-Decidido
D2018-1930accenturejobsplacement.comAccenture Global Services LimitedDomain eRegistration, Domain eRegistration -Decidido
D2018-1931legolandstore.comLEGO Juris A/S1&1 Internet Limited / Johana Juha Donado-Decidido
D2018-1932weixinzhi.com腾讯控股有限公司(Tencent Holdings Limited)Lichangzhou-Decidido
D2018-1933kboxmobilestorage.comK-BOX, LLCNicole Lewis, Marketing Cohorts-Decidido
D2018-1934boondocker.comBoondocker LLCRegistration Private, Domains By Proxy, LLC / Corey Boston-Decidido
D2018-1935myh1z1.comDaybreak Game Company LLCLv Guo Ping-Decidido
D2018-1936iqoscn.netPhilip Morris Products S.A.Jack Charls-Decidido
D2018-1937lorealfranchise.comL’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peter-Decidido
D2018-1938carrefour.giftCarrefourWhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi -Decidido
D2018-1939bgiqos.comPhilip Morris Products S.A.Hristo Aleksandrov-Decidido
D2018-1940sandozmedikal.com
sandozmedikal.xyz
Novartis AGDomain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilay-Decidido
D2018-1941careerswipro.comWIPRO LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologies-Decidido
D2018-1942sanpham3m.com3M COMPANYLe Tan Hoa, Personal-Decidido
D2018-1943pet-plan-claim-form.comPet Plan LtdOn behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc.-Decidido
D2018-1944groundup.comGround Up, Inc.DomainMarket.com-Decidido
D2018-1945geekway.comGeekway, LLCBeats-Decidido
D2018-1946hnbwi.comHiawatha National BankMartha Coe-Decidido
D2018-1947peltonandcrane.comDental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltd-Decidido
D2018-1948saizen.shopMerck KGaAYasutaka Sakatani-Decidido
D2018-1949banque-carefour.com
banque-carefour.net
CarrefourZhuhai Yingxun Keji Limited / Paul Loutin, Loutin SAS-Decidido
D2018-1950jhbqq.com腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yun-Decidido
D2018-1951vikingcruisesindia.comViking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
Registration Private, Domains By Proxy, LLC / Kiran Bhandari-Decidido
D2018-1952zf-motoraction-rallying.comZF Frledrlcbsbafen AG--Arquivado
D2018-1953skyscannerusa.comSkyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.-Decidido
D2018-1954scholasticcorp.comScholastic Inc.Private Registrant / Kenneth Cleary-Decidido
D2018-1955luisstuhlberger.comLuis StuhlbergerLaura Yun, Antarchile S.A.-Decidido
D2018-1956instagrambadge.comInstagram, LLCInstagramBadge, LLC-Decidido
D2018-1957groupon.spaceGroupon, Inc.Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wah-Decidido
D2018-1958legally.comLegally CoDomain Administrator, Namefind LLC-Decidido
D2018-1959amegybankl.comZB, N.A.Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico-Decidido
D2018-1960badgleymischkaswim.com
badgleymischkaswimwear.com
Badgley Mischka, LLCAriel Fein-Decidido
D2018-1961ibinder.netiBinder AB--Arquivado
D2018-1962authenticjordansair.comNike Innovate C.V.Li Jian Fan-Decidido
D2018-1963weixinxinyong.com腾讯控股有限公司(Tencent Holdings Limited)--Arquivado
D2018-1964weixinjingpindian.com
weixinzhengxin.com
腾讯控股有限公司(Tencent Holdings Limited)Shixue Lian-Decidido
D2018-1965nintendotencent.com腾讯控股有限公司(Tencent Holdings Limited)Yuan Bing-Decidido
D2018-1966blancpain.store
breguet.store
Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
-Decidido
D2018-1967thegapcafebar.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
Domain Whois Privacy Service / Carole Posey-Decidido
D2018-1968legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
LEGO Juris A/SMarco AntonioServin lugo, Legomexico llc
Name Redacted
Name Redacted
Name Redacted
Sagar Sunar, legokorea.llc
Wenben Zhou
-Decidido
D2018-1969wechatcredit.com腾讯控股有限公司(Tencent Holdings Limited)Pan She Ling-Decidido
D2018-1970banquecic.comCrédit Industriel et Commercial S.A.--Arquivado
D2018-1971iqossigarasitesi.comPhilip Morris Products S.A.Kadir \u015eayir, Kadir-Decidido
D2018-1972iqos-vietnam.comPhilip Morris Products S.A.Nguyen Minh Hoang-Decidido
D2018-1973shellcorporate.comShell Brands International AGJimmy Luis-Decidido
D2018-1974arcelormittaliran.comArcelormittal (SA)مسعود ثقفي-Decidido
D2018-1975haribo-de.comHARIBO GmbH & Co. KGWhois Agent, Domain Protection Services, Inc. / louane Severins-Decidido
D2018-1976arcelormittal-mexico.comArcelorMittal S.A.Ruben Gomez-Decidido
D2018-1977sticks-heets.comPhilip Morris Products S.A.Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov -Decidido
D2018-1978dealmaker.comDealMaker, LLCBrian Dillon-Ferris-Decidido
D2018-1979virgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Virgin Enterprises LimitedAbdab Consult-Decidido
D2018-1980potterybrn-shopping.worldWilliams-Sonoma, Inc.--Arquivado
D2018-1981livlabs.com
livlabsnow.com
LivOn Laboratories, IncMike Kearl-Decidido
D2018-1982advancefinance247.com
af247loan.com
af247offer.com
Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaew-Decidido
D2018-1983af247online.comHarpeth Financial Services LLC, d/b/a Advance Financial 24/7Domain Admin, Whois Privacy Corp.-Decidido
D2018-1984aeg-remont.xyzAB ElectroluxPetr Demidov-Decidido
D2018-1985carrefoursecure.comCarrefourContact Privacy Inc. Customer 0151522304 / lucas montanaro-Decidido
D2018-1986airfrance-com.win
airfrancewin.win
Société Air FranceDomain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisal-Decidido
D2018-1987skyscannerflight.comSkyscanner LimitedDomain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundation-Decidido
D2018-1988creditmutuel.expert
creditmutuel.shop
Confédération nationale du Crédit MutuelCatherine Forali-Decidido
D2018-1989gordonblucatering.comLe Cordon Bleu International B.V.Gordon Blu Spolka Z Ograniczona Odpowiedzialnoscia-Decidido
D2018-1990cordonbleuonline.comLe Cordon Bleu International B.V.Carla Rodrigues-Decidido
D2018-1991arpenaz-quechua.comDecathlonPavel Ostapenko-Decidido
D2018-1992zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
ZipRecruiter, Inc.Cyber Domain Services Private Limited
Laksh Internet Solutions Private Limited
Postoffice Mailing Solutions Pvt. Ltd
SMVS Consultancy Private Limited
Tech Domain Services Private Limited
Web Master Internet Services Private Limited
-Decidido
D2018-1993camfrog.vipCamshare, Inc.--Arquivado
D2018-1994accenturerecruitment.comAccenture Global Services LimitedDomain eRegistration-Decidido
D2018-1995fusion3.comFusion3 Design, LLCFusion3 Inc. f/k/a TradeMark Management-Decidido
D2018-1996rakuten.appRakuten, Inc.Registration Private, Domains By Proxy, LLC / Jack Lim-Decidido
D2018-1997astonmartinjp.comAston Martin Lagonda LimitedWhoisGuard Protected, WhoisGuard, Inc. / Sean Sterling -Decidido
D2018-1998turboxtax.comIntuit Inc.Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTD-Decidido
D2018-1999yurbotax.comIntuit Inc.Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202-Decidido