Case Details for WIPO Case D2018-1882

WIPO Case Summary

WIPO Case NumberD2018-1882
Domain name(s)hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
ComplainantAccor SA
SoLuxury HMC
RespondentOrlando Andres Zunino, Sofia Project
PanelistSaavedra, Gerardo
Decision Date05-10-2018
DecisionTransfer

Next Search