모든 사건: D2018-1800 - D2018-1999

최종변경일: Jul 23, 2019

사건번호 도메인이름 신청인 피신청인 절차개시일 사건 현황
D2018-1800beymenyapi.comBeymen Maǧazacılık Anonim Şirketi--종료
D2018-1801dunderfun.comDunder Limited--종료
D2018-1802belfius.appBelfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkers-결정
D2018-1803easybreath.websiteProjectClubPrivacy Protection / Alesandr Pilschikov-결정
D2018-1804rockefellerqroup.comRockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Mills-결정
D2018-1805americanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla-결정
D2018-1806chatur2018.comMulti Media, LLCWhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasya-결정
D2018-1807buylinkedinfollowers.comLinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics-결정
D2018-1808asianet.netAsianet Satellite Communications LimitedFuture Media Architects Inc.-결정
D2018-1809goindigo.comInterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-결정
D2018-18101xbet.dateNavasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko -결정
D2018-1811cic-mon-compte.reviewCrédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexis-결정
D2018-1812tangfreres.onlineTang Frerestang freres-결정
D2018-1813afflelou3d.comAlain Afflelou Franchiseur--종료
D2018-1814kikotechnology.comKiko Technology LimitedRobert Gibellini-결정
D2018-1815hidqlobal.comHID Global CorporationJohn Makinwa-결정
D2018-1816childrensoutlet.comChildrens Outlet LtdIan Davidson, Childrensalon Ltd-결정
D2018-1817arcelormittal.topArcelorMittal (SA)zhou zhou, zhou zhou-결정
D2018-1818creditmutuel.companyConfederation Nationale Du Credit MutuelDavid Leparoux-결정
D2018-1819mr-bricolage.onlineMr BricolageWhoisGuard, Inc. / Alexandre Noffy-결정
D2018-1820zanussi.online
zanussi.site
AB Electrolux--종료
D2018-1821blephacleanse.comLaboratoires Thea--종료
D2018-1822zanussi.clickAB ElectroluxRajaa Nasr-결정
D2018-1823zanussi.expertAB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.-결정
D2018-1824intercontinentalhotelaustin.comInter-Continental Hotels Corporationnibah perfect fondikum-결정
D2018-1825expensifysupport.comExpensify, Inc.--종료
D2018-1826airvape.comRoland Szegi--종료
D2018-1827oandaxmtrade.comOanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter-결정
D2018-1828buy-duromine.com
cheapduromine.com
iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.-결정
D2018-1829saphanatutorial.comSAP SESwarup Choudhuri-결정
D2018-1830allianz.travelAllianz SEInnokentiy Maskileyson-결정
D2018-1831brightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
The Brighton and Hove Albion Football Club LimitedMr. Dave Bantock-결정
D2018-1832boynerler.comBoyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boyners-결정
D2018-1833implantcast.comImplantcast GmbHBeats-결정
D2018-1834buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
-결정
D2018-1835higeen.comHouseholds & Toiletries Manufacturing Co. Ltd.Kawar, Fathi, El-Maydan Co. Oil Fields Supply-결정
D2018-1836buyduromineonline.com
duromineonline.com
iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescu-결정
D2018-1837nycifgroup.comNew York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.-결정
D2018-1838fdmag.comThe Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise -결정
D2018-1839lincolnnavigator.comFord Motor CompanyAdvert Online-결정
D2018-1840boycottbayer.comBayer AG--종료
D2018-1841bayernow.comBayer AGRegistration Private, Domains By Proxy, LLC. / Elizabeth Hulbert-결정
D2018-1842bestiqos.comPhilip Morris Products S.A.Liudinghong-결정
D2018-1843tjarcelormittal.comArcelormittal S.A.--종료
D2018-1844credit-mutuel.techConfederation Nationale du Credit MutuelMalo Corentine-결정
D2018-1845catindustrie.com
catmarbre.com
Caterpillar Inc.Sara Alaoui-결정
D2018-1846osramd.comOSRAM GmbHyue tang, tangyue-결정
D2018-1847proximus.techPROXIMUS, NV van publiek rechtWang Xiao Qin -결정
D2018-1848starstable-hack.winStar Stable Entertainment ABDawid Olszewski-결정
D2018-1849temaris.comTenaris Connections BVDomain Admin, HugeDomains.com-결정
D2018-1850fashionphileoutlet.comFashionphile, LLC--종료
D2018-1851gerbentrademark.comGerben Law Firm, PLLCWhois Privacy Corp.-결정
D2018-1852buyduromineonline.comiNova Pharmaceuticals (Singapore) Pte. Limited--종료
D2018-1853eternalfleur.comVenus et Fleur LLCDomains by Proxy, LLC / Amanda Wojtas-결정
D2018-1854ilbm.comInternational Business Machines Corporation--종료
D2018-1855credit-mutuel-confirmation-mobile.comCaisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichant-결정
D2018-1856aex.com
aex-global.com
aex88.com
Euronext N.V.Huang tian wei-결정
D2018-1857elliotttmgmt.comElliott Management Corporation--종료
D2018-1858gotmilkyet.comCalifornia Milk Processor BoardJeff Pendleton, Harvest Properties, LLC-결정
D2018-1859medium-airdrop.com
medium-news.com
A Medium CorporationProtection of Private Person / Yurii Selivanov -결정
D2018-1860mediurn.comA Medium CorporationMarat Mukhamet-결정
D2018-1861dreamstine.comDreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltd-결정
D2018-1862freetokenschaturbate.comMulti Media, LLCRegistration Private, Domains By Proxy, LLC / Apetre Andrei-결정
D2018-1863nmglego.comLEGO Juris A/S (乐高博士有限公司)Xu Yin Liang-결정
D2018-1864phillpmorris.comPhilip Morris USA Inc.--종료
D2018-1865cbdhempmeds.netMedical Marijuana, Inc.Domains By Proxy, LLC / Michael Wigton-결정
D2018-1866divorcepaperswriter.comPro Se Planning, Inc. dba DivorcewriterRegistration Private, Domains By Proxy, LLC / Bogdanov Andriy-결정
D2018-1867unifi-ip.comUbiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolle-결정
D2018-1868iqos-plus.comPhilip Morris Products S.A.Kostas Martakis-결정
D2018-1869iqos456.comPhilip Morris Products S.A.Yang Jiang Nan-결정
D2018-1870mifare.shop
mifare.store
NXP B.V.Ershov Dmitrii-결정
D2018-1871mutuelcreditinvest.comConfederation Nationale du Credit MutuelGARR Garderie-결정
D2018-1872blackiqos.comPhilip Morris Products S.A.--종료
D2018-1873iqosmy.net
iqosmy.org
Philip Morris Products S.A.Yuksel Kambal-결정
D2018-1874pmiukraine.orgProject Management Institute, Inc.Privacy Protect, LLC / Herr Thomas Henk-결정
D2018-1875valero.vipValero Energy Corporation
Valero Marketing and Supply Company
Lacey Larsen-결정
D2018-1876bartec.comBartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Brady-결정
D2018-1877newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
Artur Hasamov
Artur Hasamov, Private Person
Gustavo Frings
Moniker Privacy Services
moniker.com, Moniker Online Services, LLC
Oleksandr Nikolaienko
Protection of Private Person
-결정
D2018-1878fr-robertet.comRobertet SAMarie Claude Holler-결정
D2018-1879iqosturk.comPhilip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay-결정
D2018-1880allybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Ally Financial Inc.Zhao Hong-결정
D2018-1881capgroupco.com
thecapitalgroupco.com
The Capital Group Companies, Inc.Crystal Marie, Savoy Partners London
Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London
-결정
D2018-1882hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Project-결정
D2018-1883breitlingboutique.com
breitlingshop.com
breitlingstore.com
Breitling SAManoj Kumar Alwani-결정
D2018-1884dtccglobal.comThe Depository Trust & Clearing CorporationName Redacted-결정
D2018-1885pezo.comPezo Tech LLCPerfect Privacy, LLC / Mihalis Pourgouris-결정
D2018-1886accentureplacement.comAccenture Global Services LimitedDomain eRegistration-결정
D2018-1887spradleyford.comFord Motor CompanyWhois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Company-결정
D2018-1888chep-uk.com
chep-us.com
Brambles Ltd.WhoisGuard Protected / Emimimo Steven / avoca davis -결정
D2018-1889huntbrotherspizza.onlineHunt Family Properties, LLCLarry Lee, Phoenix Success Systems-결정
D2018-1890dreamstimes.comDreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-결정
D2018-1891mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Mou LimitedDomain Admin Privacy Protect, LLC (PrivacyProtect.org)
Luo Yuandong, Laoyuandong
Song Li Hong
Sun YanQi
Whois Agent, Domain Whois Privacy Protection Service
-결정
D2018-1892mandginvestment.comM&G LimitedSmith Taylor-결정
D2018-1893duobrii.comValeant Pharmaceuticals Ireland LimitedDomains By Proxy, LLC / Micro Duobri,New Micro Age-결정
D2018-1894halfordsgroup.comHalfords Limited--종료
D2018-1895onewheel-hoverboard.comFuture Motion, Inc.Nexperian Holding Limited / Duke Chow, Duke-결정
D2018-1896socap2018.orgSocial Capital Markets LLCDomains By Proxy, LLC / victor gill-결정
D2018-1897secure-gap.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell -결정
D2018-1898bouygues-services.comBouyguesNom anonymisé-결정
D2018-1899dreamtimes.comDreamstime.com, LLCSapphire Brands, Sapphire Brands Limited-결정
D2018-1900breezula.com
winlevi.com
Cassiopea S.p.A.--종료
D2018-1901erieicedamremovalguys.comPalumbo Services, Inc.kyle Brink, Brink Roofing-결정
D2018-1902lascal.comJoran LundhPRIVACYDOTLINK Customer 2898984 / Stanley Pace-결정
D2018-1903valero-usa.comValero Energy Corporation
Valero Marketing and Supply Company
Riaat Benn-결정
D2018-1904varta-automotlve.comJohnson Controls Hybrid and Recycling GmbHWang Jian Hua-결정
D2018-1905montar.comMontar A/SDomain Administrator, NameFind LLC-결정
D2018-1906bosch-ua.comRobert Bosch GmbHMaxim SPD CHervinchuk-결정
D2018-1907besteggloansreviews.comMarlette Funding, LLCWhois Privacy Corp-결정
D2018-1908gqme.comAdvance Magazine Publishers Inc.Robert McDonough-결정
D2018-1909tmf-gronp.comTMF Group B.V.Contact Privacy Inc. Customer 1242811003 / The Dovetail Agency-결정
D2018-1910jaegerdressessale.comKings Landing LimitedName Redacted-결정
D2018-1911virginluxuryhotels.comVirgin Enterprises LimitedZanta Consult-결정
D2018-1912decathlon-sa.comDecathlonBill Wang-결정
D2018-1913grouperexel.comRexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durand-결정
D2018-1914cic-admin.comCrédit industriel et commercial S.A.--종료
D2018-1915lotoeuromillions.comS.L.E. Service aux Loteries en EuropeSuper Privacy Service Ltd. c/o Dynadot-결정
D2018-1916loto-euro-millions-jackpot.comS.L.E. Service aux Loteries en EuropeAlbert Rajala-결정
D2018-1917euromillions-lotto.netS.L.E. Service aux Loteries en EuropeSteve Patton, Data Download -결정
D2018-1918piombo.com82 s.r.l.Chris Grivas-결정
D2018-1919t20worldcup.comICC Business Corporation FZ LLCShashank Sharma-결정
D2018-1920foreverloveibm.comInternational Business Machines CorporationWhoisGuard Protected / Richard Anderson-결정
D2018-1921ibmmonitors.netInternational Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchange-결정
D2018-1922kraftheinzcornpany.comKraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltd-결정
D2018-1923lincolnnavigator.orgFord Motor CompanyCustomer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. -결정
D2018-1924legoland-danmark.comLEGO Juris A/SAdmin Contact, PrivateName Services Inc. / Rey Leande-결정
D2018-1925freywille.orgFrey Wille GmbH & Co. KGKabir S Rawat-결정
D2018-1926bancointer.appBanco Inter S.A.Anderson Santos, leaodechacara.com-결정
D2018-1927klarnabitcoin.comKlarna Bank AB--종료
D2018-1928klarnascam.comKlarna Bank ABSuper Privacy Service LTD c/o Dynadot-결정
D2018-1929legoclone.comLEGO Juris A/SThai Dang-결정
D2018-1930accenturejobsplacement.comAccenture Global Services LimitedDomain eRegistration, Domain eRegistration -결정
D2018-1931legolandstore.comLEGO Juris A/S1&1 Internet Limited / Johana Juha Donado-결정
D2018-1932weixinzhi.com腾讯控股有限公司(Tencent Holdings Limited)Lichangzhou-결정
D2018-1933kboxmobilestorage.comK-BOX, LLCNicole Lewis, Marketing Cohorts-결정
D2018-1934boondocker.comBoondocker LLCRegistration Private, Domains By Proxy, LLC / Corey Boston-결정
D2018-1935myh1z1.comDaybreak Game Company LLCLv Guo Ping-결정
D2018-1936iqoscn.netPhilip Morris Products S.A.Jack Charls-결정
D2018-1937lorealfranchise.comL’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peter-결정
D2018-1938carrefour.giftCarrefourWhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi -결정
D2018-1939bgiqos.comPhilip Morris Products S.A.Hristo Aleksandrov-결정
D2018-1940sandozmedikal.com
sandozmedikal.xyz
Novartis AGDomain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilay-결정
D2018-1941careerswipro.comWIPRO LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologies-결정
D2018-1942sanpham3m.com3M COMPANYLe Tan Hoa, Personal-결정
D2018-1943pet-plan-claim-form.comPet Plan LtdOn behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc.-결정
D2018-1944groundup.comGround Up, Inc.DomainMarket.com-결정
D2018-1945geekway.comGeekway, LLCBeats-결정
D2018-1946hnbwi.comHiawatha National BankMartha Coe-결정
D2018-1947peltonandcrane.comDental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltd-결정
D2018-1948saizen.shopMerck KGaAYasutaka Sakatani-결정
D2018-1949banque-carefour.com
banque-carefour.net
CarrefourZhuhai Yingxun Keji Limited / Paul Loutin, Loutin SAS-결정
D2018-1950jhbqq.com腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yun-결정
D2018-1951vikingcruisesindia.comViking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
Registration Private, Domains By Proxy, LLC / Kiran Bhandari-결정
D2018-1952zf-motoraction-rallying.comZF Frledrlcbsbafen AG--종료
D2018-1953skyscannerusa.comSkyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.-결정
D2018-1954scholasticcorp.comScholastic Inc.Private Registrant / Kenneth Cleary-결정
D2018-1955luisstuhlberger.comLuis StuhlbergerLaura Yun, Antarchile S.A.-결정
D2018-1956instagrambadge.comInstagram, LLCInstagramBadge, LLC-결정
D2018-1957groupon.spaceGroupon, Inc.Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wah-결정
D2018-1958legally.comLegally CoDomain Administrator, Namefind LLC-결정
D2018-1959amegybankl.comZB, N.A.Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico-결정
D2018-1960badgleymischkaswim.com
badgleymischkaswimwear.com
Badgley Mischka, LLCAriel Fein-결정
D2018-1961ibinder.netiBinder AB--종료
D2018-1962authenticjordansair.comNike Innovate C.V.Li Jian Fan-결정
D2018-1963weixinxinyong.com腾讯控股有限公司(Tencent Holdings Limited)--종료
D2018-1964weixinjingpindian.com
weixinzhengxin.com
腾讯控股有限公司(Tencent Holdings Limited)Shixue Lian-결정
D2018-1965nintendotencent.com腾讯控股有限公司(Tencent Holdings Limited)Yuan Bing-결정
D2018-1966blancpain.store
breguet.store
Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
-결정
D2018-1967thegapcafebar.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
Domain Whois Privacy Service / Carole Posey-결정
D2018-1968legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
LEGO Juris A/SMarco AntonioServin lugo, Legomexico llc
Name Redacted
Name Redacted
Name Redacted
Sagar Sunar, legokorea.llc
Wenben Zhou
-결정
D2018-1969wechatcredit.com腾讯控股有限公司(Tencent Holdings Limited)Pan She Ling-결정
D2018-1970banquecic.comCrédit Industriel et Commercial S.A.--종료
D2018-1971iqossigarasitesi.comPhilip Morris Products S.A.Kadir \u015eayir, Kadir-결정
D2018-1972iqos-vietnam.comPhilip Morris Products S.A.Nguyen Minh Hoang-결정
D2018-1973shellcorporate.comShell Brands International AGJimmy Luis-결정
D2018-1974arcelormittaliran.comArcelormittal (SA)مسعود ثقفي-결정
D2018-1975haribo-de.comHARIBO GmbH & Co. KGWhois Agent, Domain Protection Services, Inc. / louane Severins-결정
D2018-1976arcelormittal-mexico.comArcelorMittal S.A.Ruben Gomez-결정
D2018-1977sticks-heets.comPhilip Morris Products S.A.Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov -결정
D2018-1978dealmaker.comDealMaker, LLCBrian Dillon-Ferris-결정
D2018-1979virgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Virgin Enterprises LimitedAbdab Consult-결정
D2018-1980potterybrn-shopping.worldWilliams-Sonoma, Inc.--종료
D2018-1981livlabs.com
livlabsnow.com
LivOn Laboratories, IncMike Kearl-결정
D2018-1982advancefinance247.com
af247loan.com
af247offer.com
Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaew-결정
D2018-1983af247online.comHarpeth Financial Services LLC, d/b/a Advance Financial 24/7Domain Admin, Whois Privacy Corp.-결정
D2018-1984aeg-remont.xyzAB ElectroluxPetr Demidov-결정
D2018-1985carrefoursecure.comCarrefourContact Privacy Inc. Customer 0151522304 / lucas montanaro-결정
D2018-1986airfrance-com.win
airfrancewin.win
Société Air FranceDomain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisal-결정
D2018-1987skyscannerflight.comSkyscanner LimitedDomain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundation-결정
D2018-1988creditmutuel.expert
creditmutuel.shop
Confédération nationale du Crédit MutuelCatherine Forali-결정
D2018-1989gordonblucatering.comLe Cordon Bleu International B.V.Gordon Blu Spolka Z Ograniczona Odpowiedzialnoscia-결정
D2018-1990cordonbleuonline.comLe Cordon Bleu International B.V.Carla Rodrigues-결정
D2018-1991arpenaz-quechua.comDecathlonPavel Ostapenko-결정
D2018-1992zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
ZipRecruiter, Inc.Cyber Domain Services Private Limited
Laksh Internet Solutions Private Limited
Postoffice Mailing Solutions Pvt. Ltd
SMVS Consultancy Private Limited
Tech Domain Services Private Limited
Web Master Internet Services Private Limited
-결정
D2018-1993camfrog.vipCamshare, Inc.--종료
D2018-1994accenturerecruitment.comAccenture Global Services LimitedDomain eRegistration-결정
D2018-1995fusion3.comFusion3 Design, LLCFusion3 Inc. f/k/a TradeMark Management-결정
D2018-1996rakuten.appRakuten, Inc.Registration Private, Domains By Proxy, LLC / Jack Lim-결정
D2018-1997astonmartinjp.comAston Martin Lagonda LimitedWhoisGuard Protected, WhoisGuard, Inc. / Sean Sterling -결정
D2018-1998turboxtax.comIntuit Inc.Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTD-결정
D2018-1999yurbotax.comIntuit Inc.Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202-결정