All Cases: D2018-1800 - D2018-1999

Last updated: Dec 15, 2018

Case Number Domain Name(s) Complainant Respondent Commencement Date Case Status
D2018-1800beymenyapi.comBeymen Maǧazacılık Anonim Şirketi--Terminated
D2018-1801dunderfun.comDunder Limited--Terminated
D2018-1802belfius.appBelfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkers-Decided
D2018-1803easybreath.websiteProjectClubPrivacy Protection / Alesandr Pilschikov-Decided
D2018-1804rockefellerqroup.comRockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Mills-Decided
D2018-1805americanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla-Decided
D2018-1806chatur2018.comMulti Media, LLCWhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasya-Decided
D2018-1807buylinkedinfollowers.comLinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics-Decided
D2018-1808asianet.netAsianet Satellite Communications LimitedFuture Media Architects Inc.-Decided
D2018-1809goindigo.comInterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-18101xbet.dateNavasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko -Decided
D2018-1811cic-mon-compte.reviewCrédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexis-Decided
D2018-1812tangfreres.onlineTang Frerestang freres-Decided
D2018-1813afflelou3d.comAlain Afflelou Franchiseur--Terminated
D2018-1814kikotechnology.comKiko Technology LimitedRobert Gibellini-Decided
D2018-1815hidqlobal.comHID Global CorporationJohn Makinwa-Decided
D2018-1816childrensoutlet.comChildrens Outlet LtdIan Davidson, Childrensalon Ltd-Decided
D2018-1817arcelormittal.topArcelorMittal (SA)zhou zhou, zhou zhou-Decided
D2018-1818creditmutuel.companyConfederation Nationale Du Credit MutuelDavid Leparoux-Decided
D2018-1819mr-bricolage.onlineMr BricolageWhoisGuard, Inc. / Alexandre Noffy-Decided
D2018-1820zanussi.online
zanussi.site
AB Electrolux--Terminated
D2018-1821blephacleanse.comLaboratoires Thea--Terminated
D2018-1822zanussi.clickAB ElectroluxRajaa Nasr-Decided
D2018-1823zanussi.expertAB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.-Decided
D2018-1824intercontinentalhotelaustin.comInter-Continental Hotels Corporationnibah perfect fondikum-Decided
D2018-1825expensifysupport.comExpensify, Inc.--Terminated
D2018-1826airvape.comRoland Szegi--Terminated
D2018-1827oandaxmtrade.comOanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter-Decided
D2018-1828buy-duromine.com
cheapduromine.com
iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.-Decided
D2018-1829saphanatutorial.comSAP SESwarup Choudhuri-Decided
D2018-1830allianz.travelAllianz SEInnokentiy Maskileyson-Decided
D2018-1831brightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
The Brighton and Hove Albion Football Club LimitedMr. Dave Bantock-Decided
D2018-1832boynerler.comBoyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boyners-Decided
D2018-1833implantcast.comImplantcast GmbHBeats-Decided
D2018-1834buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
-Decided
D2018-1835higeen.comHouseholds & Toiletries Manufacturing Co. Ltd.Kawar, Fathi, El-Maydan Co. Oil Fields Supply-Decided
D2018-1836buyduromineonline.com
duromineonline.com
iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescu-Decided
D2018-1837nycifgroup.comNew York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.-Decided
D2018-1838fdmag.comThe Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise -Decided
D2018-1839lincolnnavigator.comFord Motor CompanyAdvert Online-Decided
D2018-1840boycottbayer.comBayer AG--Terminated
D2018-1841bayernow.comBayer AGRegistration Private, Domains By Proxy, LLC. / Elizabeth Hulbert-Decided
D2018-1842bestiqos.comPhilip Morris Products S.A.Liudinghong-Decided
D2018-1843tjarcelormittal.comArcelormittal S.A.--Terminated
D2018-1844credit-mutuel.techConfederation Nationale du Credit MutuelMalo Corentine-Decided
D2018-1845catindustrie.com
catmarbre.com
Caterpillar Inc.Sara Alaoui-Decided
D2018-1846osramd.comOSRAM GmbHyue tang, tangyue-Decided
D2018-1847proximus.techPROXIMUS, NV van publiek rechtWang Xiao Qin -Decided
D2018-1848starstable-hack.winStar Stable Entertainment ABDawid Olszewski-Decided
D2018-1849temaris.comTenaris Connections BVDomain Admin, HugeDomains.com-Decided
D2018-1850fashionphileoutlet.comFashionphile, LLC--Terminated
D2018-1851gerbentrademark.comGerben Law Firm, PLLCWhois Privacy Corp.-Decided
D2018-1852buyduromineonline.comiNova Pharmaceuticals (Singapore) Pte. Limited--Terminated
D2018-1853eternalfleur.comVenus et Fleur LLCDomains by Proxy, LLC / Amanda Wojtas-Decided
D2018-1854ilbm.comInternational Business Machines Corporation--Terminated
D2018-1855credit-mutuel-confirmation-mobile.comCaisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichant-Decided
D2018-1856aex.com
aex-global.com
aex88.com
Euronext N.V.Huang tian wei-Decided
D2018-1857elliotttmgmt.comElliott Management Corporation--Terminated
D2018-1858gotmilkyet.comCalifornia Milk Processor BoardJeff Pendleton, Harvest Properties, LLC-Decided
D2018-1859medium-airdrop.com
medium-news.com
A Medium CorporationProtection of Private Person / Yurii Selivanov -Decided
D2018-1860mediurn.comA Medium CorporationMarat Mukhamet-Decided
D2018-1861dreamstine.comDreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-1862freetokenschaturbate.comMulti Media, LLCRegistration Private, Domains By Proxy, LLC / Apetre Andrei-Decided
D2018-1863nmglego.comLEGO Juris A/S (乐高博士有限公司)Xu Yin Liang-Decided
D2018-1864phillpmorris.comPhilip Morris USA Inc.--Terminated
D2018-1865cbdhempmeds.netMedical Marijuana, Inc.Domains By Proxy, LLC / Michael Wigton-Decided
D2018-1866divorcepaperswriter.comPro Se Planning, Inc. dba DivorcewriterRegistration Private, Domains By Proxy, LLC / Bogdanov Andriy-Decided
D2018-1867unifi-ip.comUbiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolle-Decided
D2018-1868iqos-plus.comPhilip Morris Products S.A.Kostas Martakis-Decided
D2018-1869iqos456.comPhilip Morris Products S.A.Yang Jiang Nan-Decided
D2018-1870mifare.shop
mifare.store
NXP B.V.Ershov Dmitrii-Decided
D2018-1871mutuelcreditinvest.comConfederation Nationale du Credit MutuelGARR Garderie-Decided
D2018-1872blackiqos.comPhilip Morris Products S.A.--Terminated
D2018-1873iqosmy.net
iqosmy.org
Philip Morris Products S.A.Yuksel Kambal-Decided
D2018-1874pmiukraine.orgProject Management Institute, Inc.Privacy Protect, LLC / Herr Thomas Henk-Decided
D2018-1875valero.vipValero Energy Corporation
Valero Marketing and Supply Company
Lacey Larsen-Decided
D2018-1876bartec.comBartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Brady-Decided
D2018-1877newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
Artur Hasamov
Artur Hasamov, Private Person
Gustavo Frings
Moniker Privacy Services
moniker.com, Moniker Online Services, LLC
Oleksandr Nikolaienko
Protection of Private Person
-Decided
D2018-1878fr-robertet.comRobertet SAMarie Claude Holler-Decided
D2018-1879iqosturk.comPhilip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay-Decided
D2018-1880allybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Ally Financial Inc.Zhao Hong-Decided
D2018-1881capgroupco.com
thecapitalgroupco.com
The Capital Group Companies, Inc.Crystal Marie, Savoy Partners London
Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London
-Decided
D2018-1882hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Project-Decided
D2018-1883breitlingboutique.com
breitlingshop.com
breitlingstore.com
Breitling SAManoj Kumar Alwani-Decided
D2018-1884dtccglobal.comThe Depository Trust & Clearing CorporationName Redacted-Decided
D2018-1885pezo.comPezo Tech LLCPerfect Privacy, LLC / Mihalis Pourgouris-Decided
D2018-1886accentureplacement.comAccenture Global Services LimitedDomain eRegistration-Decided
D2018-1887spradleyford.comFord Motor CompanyWhois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Company-Decided
D2018-1888chep-uk.com
chep-us.com
Brambles Ltd.WhoisGuard Protected / Emimimo Steven / avoca davis -Decided
D2018-1889huntbrotherspizza.onlineHunt Family Properties, LLCLarry Lee, Phoenix Success Systems-Decided
D2018-1890dreamstimes.comDreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-1891mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Mou LimitedDomain Admin Privacy Protect, LLC (PrivacyProtect.org)
Luo Yuandong, Laoyuandong
Song Li Hong
Sun YanQi
Whois Agent, Domain Whois Privacy Protection Service
-Decided
D2018-1892mandginvestment.comM&G LimitedSmith Taylor-Decided
D2018-1893duobrii.comValeant Pharmaceuticals Ireland LimitedDomains By Proxy, LLC / Micro Duobri,New Micro Age-Decided
D2018-1894halfordsgroup.comHalfords Limited--Terminated
D2018-1895onewheel-hoverboard.comFuture Motion, Inc.Nexperian Holding Limited / Duke Chow, Duke-Decided
D2018-1896socap2018.orgSocial Capital Markets LLCDomains By Proxy, LLC / victor gill-Decided
D2018-1897secure-gap.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell -Decided
D2018-1898bouygues-services.comBouyguesNom anonymisé-Decided
D2018-1899dreamtimes.comDreamstime.com, LLCSapphire Brands, Sapphire Brands Limited-Decided
D2018-1900breezula.com
winlevi.com
Cassiopea S.p.A.--Terminated
D2018-1901erieicedamremovalguys.comPalumbo Services, Inc.kyle Brink, Brink Roofing-Decided
D2018-1902lascal.comJoran LundhPRIVACYDOTLINK Customer 2898984 / Stanley Pace-Decided
D2018-1903valero-usa.comValero Energy Corporation
Valero Marketing and Supply Company
Riaat Benn-Decided
D2018-1904varta-automotlve.comJohnson Controls Hybrid and Recycling GmbHWang Jian Hua-Decided
D2018-1905montar.comMontar A/SDomain Administrator, NameFind LLC-Decided
D2018-1906bosch-ua.comRobert Bosch GmbHMaxim SPD CHervinchuk-Decided
D2018-1907besteggloansreviews.comMarlette Funding, LLCWhois Privacy Corp-Decided
D2018-1908gqme.comAdvance Magazine Publishers Inc.Robert McDonough-Decided
D2018-1909tmf-gronp.comTMF Group B.V.Contact Privacy Inc. Customer 1242811003 / The Dovetail Agency-Decided
D2018-1910jaegerdressessale.comKings Landing LimitedName Redacted-Decided
D2018-1911virginluxuryhotels.comVirgin Enterprises LimitedZanta Consult-Decided
D2018-1912decathlon-sa.comDecathlonBill Wang-Decided
D2018-1913grouperexel.comRexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durand-Decided
D2018-1914cic-admin.comCrédit industriel et commercial S.A.--Terminated
D2018-1915lotoeuromillions.comS.L.E. Service aux Loteries en EuropeSuper Privacy Service Ltd. c/o Dynadot-Decided
D2018-1916loto-euro-millions-jackpot.comS.L.E. Service aux Loteries en EuropeAlbert Rajala-Decided
D2018-1917euromillions-lotto.netS.L.E. Service aux Loteries en EuropeSteve Patton, Data Download -Decided
D2018-1918piombo.com82 s.r.l.Chris Grivas-Decided
D2018-1919t20worldcup.comICC Business Corporation FZ LLCShashank Sharma-Decided
D2018-1920foreverloveibm.comInternational Business Machines CorporationWhoisGuard Protected / Richard Anderson-Decided
D2018-1921ibmmonitors.netInternational Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchange-Decided
D2018-1922kraftheinzcornpany.comKraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltd-Decided
D2018-1923lincolnnavigator.orgFord Motor CompanyCustomer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. -Decided
D2018-1924legoland-danmark.comLEGO Juris A/SAdmin Contact, PrivateName Services Inc. / Rey Leande-Decided
D2018-1925freywille.orgFrey Wille GmbH & Co. KGKabir S Rawat-Decided
D2018-1926bancointer.appBanco Inter S.A.Anderson Santos, leaodechacara.com-Decided
D2018-1927klarnabitcoin.comKlarna Bank AB--Terminated
D2018-1928klarnascam.comKlarna Bank ABSuper Privacy Service LTD c/o Dynadot-Decided
D2018-1929legoclone.comLEGO Juris A/SThai Dang-Decided
D2018-1930accenturejobsplacement.comAccenture Global Services LimitedDomain eRegistration, Domain eRegistration -Decided
D2018-1931legolandstore.comLEGO Juris A/S1&1 Internet Limited / Johana Juha Donado-Decided
D2018-1932weixinzhi.com腾讯控股有限公司(Tencent Holdings Limited)Lichangzhou-Decided
D2018-1933kboxmobilestorage.comK-BOX, LLCNicole Lewis, Marketing Cohorts-Decided
D2018-1934boondocker.comBoondocker LLCRegistration Private, Domains By Proxy, LLC / Corey Boston-Decided
D2018-1935myh1z1.comDaybreak Game Company LLC-October 18, 2018Pending
D2018-1936iqoscn.netPhilip Morris Products S.A.Jack Charls-Decided
D2018-1937lorealfranchise.comL’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peter-Decided
D2018-1938carrefour.giftCarrefourWhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi -Decided
D2018-1939bgiqos.comPhilip Morris Products S.A.Hristo Aleksandrov-Decided
D2018-1940sandozmedikal.com
sandozmedikal.xyz
Novartis AGDomain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilay-Decided
D2018-1941careerswipro.comWIPRO LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologies-Decided
D2018-1942sanpham3m.com3M COMPANYLe Tan Hoa, Personal-Decided
D2018-1943pet-plan-claim-form.comPet Plan LtdOn behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc.-Decided
D2018-1944groundup.comGround Up, Inc.DomainMarket.com-Decided
D2018-1945geekway.comGeekway, LLCBeats-Decided
D2018-1946hnbwi.comHiawatha National BankMartha Coe-Decided
D2018-1947peltonandcrane.comDental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltd-Decided
D2018-1948saizen.shopMerck KGaAYasutaka Sakatani-Decided
D2018-1949banque-carefour.com
banque-carefour.net
CarrefourZhuhai Yingxun Keji Limited / Paul Loutin, Loutin SAS-Decided
D2018-1950jhbqq.com腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yun-Decided
D2018-1951vikingcruisesindia.comViking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
Registration Private, Domains By Proxy, LLC / Kiran Bhandari-Decided
D2018-1952zf-motoraction-rallying.comZF Frledrlcbsbafen AG--Terminated
D2018-1953skyscannerusa.comSkyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.-Decided
D2018-1954scholasticcorp.comScholastic Inc.Private Registrant / Kenneth Cleary-Decided
D2018-1955luisstuhlberger.comLuis StuhlbergerLaura Yun, Antarchile S.A.-Decided
D2018-1956instagrambadge.comInstagram, LLCInstagramBadge, LLC-Decided
D2018-1957groupon.spaceGroupon, Inc.Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wah-Decided
D2018-1958legally.comLegally CoDomain Administrator, Namefind LLC-Decided
D2018-1959amegybankl.comZB, N.A.Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico-Decided
D2018-1960badgleymischkaswim.com
badgleymischkaswimwear.com
Badgley Mischka, LLCAriel Fein-Decided
D2018-1961ibinder.netiBinder AB--Terminated
D2018-1962authenticjordansair.comNike Innovate C.V.Li Jian Fan-Decided
D2018-1963weixinxinyong.com腾讯控股有限公司(Tencent Holdings Limited)--Terminated
D2018-1964weixinjingpindian.com
weixinzhengxin.com
腾讯控股有限公司(Tencent Holdings Limited)Shixue Lian-Decided
D2018-1965nintendotencent.com腾讯控股有限公司(Tencent Holdings Limited)Yuan Bing-Decided
D2018-1966blancpain.store
breguet.store
Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
-Decided
D2018-1967thegapcafebar.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
Domain Whois Privacy Service / Carole Posey-Decided
D2018-1968legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
LEGO Juris A/SMarco AntonioServin lugo, Legomexico llc
Name Redacted
Name Redacted
Name Redacted
Sagar Sunar, legokorea.llc
Wenben Zhou
-Decided
D2018-1969wechatcredit.com腾讯控股有限公司(Tencent Holdings Limited)Pan She Ling-Decided
D2018-1970banquecic.comCrédit Industriel et Commercial S.A.--Terminated
D2018-1971iqossigarasitesi.comPhilip Morris Products S.A.Kadir \u015eayir, Kadir-Decided
D2018-1972iqos-vietnam.comPhilip Morris Products S.A.Nguyen Minh Hoang-Decided
D2018-1973shellcorporate.comShell Brands International AGJimmy Luis-Decided
D2018-1974arcelormittaliran.comArcelormittal (SA)مسعود ثقفي-Decided
D2018-1975haribo-de.comHARIBO GmbH & Co. KGWhois Agent, Domain Protection Services, Inc. / louane Severins-Decided
D2018-1976arcelormittal-mexico.comArcelorMittal S.A.Ruben Gomez-Decided
D2018-1977sticks-heets.comPhilip Morris Products S.A.Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov -Decided
D2018-1978dealmaker.comDealMaker, LLC-September 13, 2018Pending
D2018-1979virgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Virgin Enterprises LimitedAbdab Consult-Decided
D2018-1980potterybrn-shopping.worldWilliams-Sonoma, Inc.--Terminated
D2018-1981livlabs.com
livlabsnow.com
LivOn Laboratories, IncMike Kearl-Decided
D2018-1982advancefinance247.com
af247loan.com
af247offer.com
Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaew-Decided
D2018-1983af247online.comHarpeth Financial Services LLC, d/b/a Advance Financial 24/7Domain Admin, Whois Privacy Corp.-Decided
D2018-1984aeg-remont.xyzAB ElectroluxPetr Demidov-Decided
D2018-1985carrefoursecure.comCarrefourContact Privacy Inc. Customer 0151522304 / lucas montanaro-Decided
D2018-1986airfrance-com.win
airfrancewin.win
Société Air FranceDomain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisal-Decided
D2018-1987skyscannerflight.comSkyscanner LimitedDomain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundation-Decided
D2018-1988creditmutuel.expert
creditmutuel.shop
Confédération nationale du Crédit MutuelCatherine Forali-Decided
D2018-1989gordonblucatering.comLe Cordon Bleu International B.V.Gordon Blu Spolka Z Ograniczona Odpowiedzialnoscia-Decided
D2018-1990cordonbleuonline.comLe Cordon Bleu International B.V.Carla Rodrigues-Decided
D2018-1991arpenaz-quechua.comDecathlonPavel Ostapenko-Decided
D2018-1992zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
ZipRecruiter, Inc.Cyber Domain Services Private Limited
Laksh Internet Solutions Private Limited
Postoffice Mailing Solutions Pvt. Ltd
SMVS Consultancy Private Limited
Tech Domain Services Private Limited
Web Master Internet Services Private Limited
-Decided
D2018-1993camfrog.vipCamshare, Inc.--Terminated
D2018-1994accenturerecruitment.comAccenture Global Services LimitedDomain eRegistration-Decided
D2018-1995fusion3.comFusion3 Design, LLCFusion3 Inc. f/k/a TradeMark Management-Decided
D2018-1996rakuten.appRakuten, Inc.Registration Private, Domains By Proxy, LLC / Jack Lim-Decided
D2018-1997astonmartinjp.comAston Martin Lagonda Limited-November 12, 2018Pending
D2018-1998turboxtax.comIntuit Inc.Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTD-Decided
D2018-1999yurbotax.comIntuit Inc.Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202-Decided