Liste des affaires: D2018-1800 - D2018-1999

Dernière actualisation: 21 avr. 2019

Numéro du litige Nom(s) de domaine Requérant Défendeur Date de début de la procédure Statut du cas
D2018-1800beymenyapi.comBeymen Maǧazacılık Anonim Şirketi--Classé
D2018-1801dunderfun.comDunder Limited--Classé
D2018-1802belfius.appBelfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkers-Tranché
D2018-1803easybreath.websiteProjectClubPrivacy Protection / Alesandr Pilschikov-Tranché
D2018-1804rockefellerqroup.comRockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Mills-Tranché
D2018-1805americanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla-Tranché
D2018-1806chatur2018.comMulti Media, LLCWhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasya-Tranché
D2018-1807buylinkedinfollowers.comLinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics-Tranché
D2018-1808asianet.netAsianet Satellite Communications LimitedFuture Media Architects Inc.-Tranché
D2018-1809goindigo.comInterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Tranché
D2018-18101xbet.dateNavasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko -Tranché
D2018-1811cic-mon-compte.reviewCrédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexis-Tranché
D2018-1812tangfreres.onlineTang Frerestang freres-Tranché
D2018-1813afflelou3d.comAlain Afflelou Franchiseur--Classé
D2018-1814kikotechnology.comKiko Technology LimitedRobert Gibellini-Tranché
D2018-1815hidqlobal.comHID Global CorporationJohn Makinwa-Tranché
D2018-1816childrensoutlet.comChildrens Outlet LtdIan Davidson, Childrensalon Ltd-Tranché
D2018-1817arcelormittal.topArcelorMittal (SA)zhou zhou, zhou zhou-Tranché
D2018-1818creditmutuel.companyConfederation Nationale Du Credit MutuelDavid Leparoux-Tranché
D2018-1819mr-bricolage.onlineMr BricolageWhoisGuard, Inc. / Alexandre Noffy-Tranché
D2018-1820zanussi.online
zanussi.site
AB Electrolux--Classé
D2018-1821blephacleanse.comLaboratoires Thea--Classé
D2018-1822zanussi.clickAB ElectroluxRajaa Nasr-Tranché
D2018-1823zanussi.expertAB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.-Tranché
D2018-1824intercontinentalhotelaustin.comInter-Continental Hotels Corporationnibah perfect fondikum-Tranché
D2018-1825expensifysupport.comExpensify, Inc.--Classé
D2018-1826airvape.comRoland Szegi--Classé
D2018-1827oandaxmtrade.comOanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter-Tranché
D2018-1828buy-duromine.com
cheapduromine.com
iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.-Tranché
D2018-1829saphanatutorial.comSAP SESwarup Choudhuri-Tranché
D2018-1830allianz.travelAllianz SEInnokentiy Maskileyson-Tranché
D2018-1831brightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
The Brighton and Hove Albion Football Club LimitedMr. Dave Bantock-Tranché
D2018-1832boynerler.comBoyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boyners-Tranché
D2018-1833implantcast.comImplantcast GmbHBeats-Tranché
D2018-1834buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
-Tranché
D2018-1835higeen.comHouseholds & Toiletries Manufacturing Co. Ltd.Kawar, Fathi, El-Maydan Co. Oil Fields Supply-Tranché
D2018-1836buyduromineonline.com
duromineonline.com
iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescu-Tranché
D2018-1837nycifgroup.comNew York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.-Tranché
D2018-1838fdmag.comThe Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise -Tranché
D2018-1839lincolnnavigator.comFord Motor CompanyAdvert Online-Tranché
D2018-1840boycottbayer.comBayer AG--Classé
D2018-1841bayernow.comBayer AGRegistration Private, Domains By Proxy, LLC. / Elizabeth Hulbert-Tranché
D2018-1842bestiqos.comPhilip Morris Products S.A.Liudinghong-Tranché
D2018-1843tjarcelormittal.comArcelormittal S.A.--Classé
D2018-1844credit-mutuel.techConfederation Nationale du Credit MutuelMalo Corentine-Tranché
D2018-1845catindustrie.com
catmarbre.com
Caterpillar Inc.Sara Alaoui-Tranché
D2018-1846osramd.comOSRAM GmbHyue tang, tangyue-Tranché
D2018-1847proximus.techPROXIMUS, NV van publiek rechtWang Xiao Qin -Tranché
D2018-1848starstable-hack.winStar Stable Entertainment ABDawid Olszewski-Tranché
D2018-1849temaris.comTenaris Connections BVDomain Admin, HugeDomains.com-Tranché
D2018-1850fashionphileoutlet.comFashionphile, LLC--Classé
D2018-1851gerbentrademark.comGerben Law Firm, PLLCWhois Privacy Corp.-Tranché
D2018-1852buyduromineonline.comiNova Pharmaceuticals (Singapore) Pte. Limited--Classé
D2018-1853eternalfleur.comVenus et Fleur LLCDomains by Proxy, LLC / Amanda Wojtas-Tranché
D2018-1854ilbm.comInternational Business Machines Corporation--Classé
D2018-1855credit-mutuel-confirmation-mobile.comCaisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichant-Tranché
D2018-1856aex.com
aex-global.com
aex88.com
Euronext N.V.Huang tian wei-Tranché
D2018-1857elliotttmgmt.comElliott Management Corporation--Classé
D2018-1858gotmilkyet.comCalifornia Milk Processor BoardJeff Pendleton, Harvest Properties, LLC-Tranché
D2018-1859medium-airdrop.com
medium-news.com
A Medium CorporationProtection of Private Person / Yurii Selivanov -Tranché
D2018-1860mediurn.comA Medium CorporationMarat Mukhamet-Tranché
D2018-1861dreamstine.comDreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Tranché
D2018-1862freetokenschaturbate.comMulti Media, LLCRegistration Private, Domains By Proxy, LLC / Apetre Andrei-Tranché
D2018-1863nmglego.comLEGO Juris A/S (乐高博士有限公司)Xu Yin Liang-Tranché
D2018-1864phillpmorris.comPhilip Morris USA Inc.--Classé
D2018-1865cbdhempmeds.netMedical Marijuana, Inc.Domains By Proxy, LLC / Michael Wigton-Tranché
D2018-1866divorcepaperswriter.comPro Se Planning, Inc. dba DivorcewriterRegistration Private, Domains By Proxy, LLC / Bogdanov Andriy-Tranché
D2018-1867unifi-ip.comUbiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolle-Tranché
D2018-1868iqos-plus.comPhilip Morris Products S.A.Kostas Martakis-Tranché
D2018-1869iqos456.comPhilip Morris Products S.A.Yang Jiang Nan-Tranché
D2018-1870mifare.shop
mifare.store
NXP B.V.Ershov Dmitrii-Tranché
D2018-1871mutuelcreditinvest.comConfederation Nationale du Credit MutuelGARR Garderie-Tranché
D2018-1872blackiqos.comPhilip Morris Products S.A.--Classé
D2018-1873iqosmy.net
iqosmy.org
Philip Morris Products S.A.Yuksel Kambal-Tranché
D2018-1874pmiukraine.orgProject Management Institute, Inc.Privacy Protect, LLC / Herr Thomas Henk-Tranché
D2018-1875valero.vipValero Energy Corporation
Valero Marketing and Supply Company
Lacey Larsen-Tranché
D2018-1876bartec.comBartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Brady-Tranché
D2018-1877newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
Artur Hasamov
Artur Hasamov, Private Person
Gustavo Frings
Moniker Privacy Services
moniker.com, Moniker Online Services, LLC
Oleksandr Nikolaienko
Protection of Private Person
-Tranché
D2018-1878fr-robertet.comRobertet SAMarie Claude Holler-Tranché
D2018-1879iqosturk.comPhilip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay-Tranché
D2018-1880allybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Ally Financial Inc.Zhao Hong-Tranché
D2018-1881capgroupco.com
thecapitalgroupco.com
The Capital Group Companies, Inc.Crystal Marie, Savoy Partners London
Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London
-Tranché
D2018-1882hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Project-Tranché
D2018-1883breitlingboutique.com
breitlingshop.com
breitlingstore.com
Breitling SAManoj Kumar Alwani-Tranché
D2018-1884dtccglobal.comThe Depository Trust & Clearing CorporationName Redacted-Tranché
D2018-1885pezo.comPezo Tech LLCPerfect Privacy, LLC / Mihalis Pourgouris-Tranché
D2018-1886accentureplacement.comAccenture Global Services LimitedDomain eRegistration-Tranché
D2018-1887spradleyford.comFord Motor CompanyWhois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Company-Tranché
D2018-1888chep-uk.com
chep-us.com
Brambles Ltd.WhoisGuard Protected / Emimimo Steven / avoca davis -Tranché
D2018-1889huntbrotherspizza.onlineHunt Family Properties, LLCLarry Lee, Phoenix Success Systems-Tranché
D2018-1890dreamstimes.comDreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Tranché
D2018-1891mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Mou LimitedDomain Admin Privacy Protect, LLC (PrivacyProtect.org)
Luo Yuandong, Laoyuandong
Song Li Hong
Sun YanQi
Whois Agent, Domain Whois Privacy Protection Service
-Tranché
D2018-1892mandginvestment.comM&G LimitedSmith Taylor-Tranché
D2018-1893duobrii.comValeant Pharmaceuticals Ireland LimitedDomains By Proxy, LLC / Micro Duobri,New Micro Age-Tranché
D2018-1894halfordsgroup.comHalfords Limited--Classé
D2018-1895onewheel-hoverboard.comFuture Motion, Inc.Nexperian Holding Limited / Duke Chow, Duke-Tranché
D2018-1896socap2018.orgSocial Capital Markets LLCDomains By Proxy, LLC / victor gill-Tranché
D2018-1897secure-gap.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell -Tranché
D2018-1898bouygues-services.comBouyguesNom anonymisé-Tranché
D2018-1899dreamtimes.comDreamstime.com, LLCSapphire Brands, Sapphire Brands Limited-Tranché
D2018-1900breezula.com
winlevi.com
Cassiopea S.p.A.--Classé
D2018-1901erieicedamremovalguys.comPalumbo Services, Inc.kyle Brink, Brink Roofing-Tranché
D2018-1902lascal.comJoran LundhPRIVACYDOTLINK Customer 2898984 / Stanley Pace-Tranché
D2018-1903valero-usa.comValero Energy Corporation
Valero Marketing and Supply Company
Riaat Benn-Tranché
D2018-1904varta-automotlve.comJohnson Controls Hybrid and Recycling GmbHWang Jian Hua-Tranché
D2018-1905montar.comMontar A/SDomain Administrator, NameFind LLC-Tranché
D2018-1906bosch-ua.comRobert Bosch GmbHMaxim SPD CHervinchuk-Tranché
D2018-1907besteggloansreviews.comMarlette Funding, LLCWhois Privacy Corp-Tranché
D2018-1908gqme.comAdvance Magazine Publishers Inc.Robert McDonough-Tranché
D2018-1909tmf-gronp.comTMF Group B.V.Contact Privacy Inc. Customer 1242811003 / The Dovetail Agency-Tranché
D2018-1910jaegerdressessale.comKings Landing LimitedName Redacted-Tranché
D2018-1911virginluxuryhotels.comVirgin Enterprises LimitedZanta Consult-Tranché
D2018-1912decathlon-sa.comDecathlonBill Wang-Tranché
D2018-1913grouperexel.comRexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durand-Tranché
D2018-1914cic-admin.comCrédit industriel et commercial S.A.--Classé
D2018-1915lotoeuromillions.comS.L.E. Service aux Loteries en EuropeSuper Privacy Service Ltd. c/o Dynadot-Tranché
D2018-1916loto-euro-millions-jackpot.comS.L.E. Service aux Loteries en EuropeAlbert Rajala-Tranché
D2018-1917euromillions-lotto.netS.L.E. Service aux Loteries en EuropeSteve Patton, Data Download -Tranché
D2018-1918piombo.com82 s.r.l.Chris Grivas-Tranché
D2018-1919t20worldcup.comICC Business Corporation FZ LLCShashank Sharma-Tranché
D2018-1920foreverloveibm.comInternational Business Machines CorporationWhoisGuard Protected / Richard Anderson-Tranché
D2018-1921ibmmonitors.netInternational Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchange-Tranché
D2018-1922kraftheinzcornpany.comKraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltd-Tranché
D2018-1923lincolnnavigator.orgFord Motor CompanyCustomer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. -Tranché
D2018-1924legoland-danmark.comLEGO Juris A/SAdmin Contact, PrivateName Services Inc. / Rey Leande-Tranché
D2018-1925freywille.orgFrey Wille GmbH & Co. KGKabir S Rawat-Tranché
D2018-1926bancointer.appBanco Inter S.A.Anderson Santos, leaodechacara.com-Tranché
D2018-1927klarnabitcoin.comKlarna Bank AB--Classé
D2018-1928klarnascam.comKlarna Bank ABSuper Privacy Service LTD c/o Dynadot-Tranché
D2018-1929legoclone.comLEGO Juris A/SThai Dang-Tranché
D2018-1930accenturejobsplacement.comAccenture Global Services LimitedDomain eRegistration, Domain eRegistration -Tranché
D2018-1931legolandstore.comLEGO Juris A/S1&1 Internet Limited / Johana Juha Donado-Tranché
D2018-1932weixinzhi.com腾讯控股有限公司(Tencent Holdings Limited)Lichangzhou-Tranché
D2018-1933kboxmobilestorage.comK-BOX, LLCNicole Lewis, Marketing Cohorts-Tranché
D2018-1934boondocker.comBoondocker LLCRegistration Private, Domains By Proxy, LLC / Corey Boston-Tranché
D2018-1935myh1z1.comDaybreak Game Company LLCLv Guo Ping-Tranché
D2018-1936iqoscn.netPhilip Morris Products S.A.Jack Charls-Tranché
D2018-1937lorealfranchise.comL’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peter-Tranché
D2018-1938carrefour.giftCarrefourWhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi -Tranché
D2018-1939bgiqos.comPhilip Morris Products S.A.Hristo Aleksandrov-Tranché
D2018-1940sandozmedikal.com
sandozmedikal.xyz
Novartis AGDomain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilay-Tranché
D2018-1941careerswipro.comWIPRO LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologies-Tranché
D2018-1942sanpham3m.com3M COMPANYLe Tan Hoa, Personal-Tranché
D2018-1943pet-plan-claim-form.comPet Plan LtdOn behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc.-Tranché
D2018-1944groundup.comGround Up, Inc.DomainMarket.com-Tranché
D2018-1945geekway.comGeekway, LLCBeats-Tranché
D2018-1946hnbwi.comHiawatha National BankMartha Coe-Tranché
D2018-1947peltonandcrane.comDental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltd-Tranché
D2018-1948saizen.shopMerck KGaAYasutaka Sakatani-Tranché
D2018-1949banque-carefour.com
banque-carefour.net
CarrefourZhuhai Yingxun Keji Limited / Paul Loutin, Loutin SAS-Tranché
D2018-1950jhbqq.com腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yun-Tranché
D2018-1951vikingcruisesindia.comViking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
Registration Private, Domains By Proxy, LLC / Kiran Bhandari-Tranché
D2018-1952zf-motoraction-rallying.comZF Frledrlcbsbafen AG--Classé
D2018-1953skyscannerusa.comSkyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.-Tranché
D2018-1954scholasticcorp.comScholastic Inc.Private Registrant / Kenneth Cleary-Tranché
D2018-1955luisstuhlberger.comLuis StuhlbergerLaura Yun, Antarchile S.A.-Tranché
D2018-1956instagrambadge.comInstagram, LLCInstagramBadge, LLC-Tranché
D2018-1957groupon.spaceGroupon, Inc.Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wah-Tranché
D2018-1958legally.comLegally CoDomain Administrator, Namefind LLC-Tranché
D2018-1959amegybankl.comZB, N.A.Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico-Tranché
D2018-1960badgleymischkaswim.com
badgleymischkaswimwear.com
Badgley Mischka, LLCAriel Fein-Tranché
D2018-1961ibinder.netiBinder AB--Classé
D2018-1962authenticjordansair.comNike Innovate C.V.Li Jian Fan-Tranché
D2018-1963weixinxinyong.com腾讯控股有限公司(Tencent Holdings Limited)--Classé
D2018-1964weixinjingpindian.com
weixinzhengxin.com
腾讯控股有限公司(Tencent Holdings Limited)Shixue Lian-Tranché
D2018-1965nintendotencent.com腾讯控股有限公司(Tencent Holdings Limited)Yuan Bing-Tranché
D2018-1966blancpain.store
breguet.store
Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
-Tranché
D2018-1967thegapcafebar.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
Domain Whois Privacy Service / Carole Posey-Tranché
D2018-1968legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
LEGO Juris A/SMarco AntonioServin lugo, Legomexico llc
Name Redacted
Name Redacted
Name Redacted
Sagar Sunar, legokorea.llc
Wenben Zhou
-Tranché
D2018-1969wechatcredit.com腾讯控股有限公司(Tencent Holdings Limited)Pan She Ling-Tranché
D2018-1970banquecic.comCrédit Industriel et Commercial S.A.--Classé
D2018-1971iqossigarasitesi.comPhilip Morris Products S.A.Kadir \u015eayir, Kadir-Tranché
D2018-1972iqos-vietnam.comPhilip Morris Products S.A.Nguyen Minh Hoang-Tranché
D2018-1973shellcorporate.comShell Brands International AGJimmy Luis-Tranché
D2018-1974arcelormittaliran.comArcelormittal (SA)مسعود ثقفي-Tranché
D2018-1975haribo-de.comHARIBO GmbH & Co. KGWhois Agent, Domain Protection Services, Inc. / louane Severins-Tranché
D2018-1976arcelormittal-mexico.comArcelorMittal S.A.Ruben Gomez-Tranché
D2018-1977sticks-heets.comPhilip Morris Products S.A.Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov -Tranché
D2018-1978dealmaker.comDealMaker, LLCBrian Dillon-Ferris-Tranché
D2018-1979virgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Virgin Enterprises LimitedAbdab Consult-Tranché
D2018-1980potterybrn-shopping.worldWilliams-Sonoma, Inc.--Classé
D2018-1981livlabs.com
livlabsnow.com
LivOn Laboratories, IncMike Kearl-Tranché
D2018-1982advancefinance247.com
af247loan.com
af247offer.com
Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaew-Tranché
D2018-1983af247online.comHarpeth Financial Services LLC, d/b/a Advance Financial 24/7Domain Admin, Whois Privacy Corp.-Tranché
D2018-1984aeg-remont.xyzAB ElectroluxPetr Demidov-Tranché
D2018-1985carrefoursecure.comCarrefourContact Privacy Inc. Customer 0151522304 / lucas montanaro-Tranché
D2018-1986airfrance-com.win
airfrancewin.win
Société Air FranceDomain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisal-Tranché
D2018-1987skyscannerflight.comSkyscanner LimitedDomain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundation-Tranché
D2018-1988creditmutuel.expert
creditmutuel.shop
Confédération nationale du Crédit MutuelCatherine Forali-Tranché
D2018-1989gordonblucatering.comLe Cordon Bleu International B.V.Gordon Blu Spolka Z Ograniczona Odpowiedzialnoscia-Tranché
D2018-1990cordonbleuonline.comLe Cordon Bleu International B.V.Carla Rodrigues-Tranché
D2018-1991arpenaz-quechua.comDecathlonPavel Ostapenko-Tranché
D2018-1992zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
ZipRecruiter, Inc.Cyber Domain Services Private Limited
Laksh Internet Solutions Private Limited
Postoffice Mailing Solutions Pvt. Ltd
SMVS Consultancy Private Limited
Tech Domain Services Private Limited
Web Master Internet Services Private Limited
-Tranché
D2018-1993camfrog.vipCamshare, Inc.--Classé
D2018-1994accenturerecruitment.comAccenture Global Services LimitedDomain eRegistration-Tranché
D2018-1995fusion3.comFusion3 Design, LLCFusion3 Inc. f/k/a TradeMark Management-Tranché
D2018-1996rakuten.appRakuten, Inc.Registration Private, Domains By Proxy, LLC / Jack Lim-Tranché
D2018-1997astonmartinjp.comAston Martin Lagonda LimitedWhoisGuard Protected, WhoisGuard, Inc. / Sean Sterling -Tranché
D2018-1998turboxtax.comIntuit Inc.Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTD-Tranché
D2018-1999yurbotax.comIntuit Inc.Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202-Tranché