ABCD#1234 Johannes Jäger Johannes Jaeger Pharmakologische Wirkstoffe für das Nervensystem 122 7 AA PAT SITE 1 note D-Alanine SITE 2 note D-Glutamic acid SITE 4 note Nle SITE 6 note D-Methionine SITE 7 note D-Norleucine REGION 1..7 note circular peptide source 1..7 mol_type protein organism Homo sapiens AEKXGMX 6 AA PAT SITE 1 note the N-terminus is acetylated SITE 4 note 6-amino-7-(1H-indol-3-yl)-5-oxoheptanoic acid SITE 6 note the C-terminus is methylated source 1..6 mol_type protein organism Homo sapiens VAFWGK 000 5 AA PAT VARIANT 5 note X can be any amino acid REGION >5 note The entire sequence of amino acids 1-5 can be repeated one or more times source 1..5 mol_type protein organism Homo sapiens GGGGX 12 DNA PAT misc_feature 12 note cytosine attached to a C3 spacer, which is joined to another nucleic acid source 1..12 mol_type other DNA organism synthetic construct atgcatgcatgc 12 DNA PAT misc_feature 1 note cytosine attached to a C3 spacer, which is joined to another nucleic acid source 1..12 mol_type other DNA organism synthetic construct cggcatgcatgc 25 DNA PAT source 1..25 mol_type genomic DNA organism Mus musculus atgcatgcatgcvcggcatgcatgc 12 DNA PAT misc_feature 12 note cytosine is linked to a C3 spacer, which is linked to 5'-end of another nucleic acid source 1..12 mol_type other DNA organism synthetic construct atgcatgcatgc 12 DNA PAT misc_feature 1 note cytosine is linked to a C3 spacer, which is linked to 3'-end of another nucleic acid source 1..12 mol_type other DNA organism synthetic construct cggcatgcatgc 18 DNA PAT modified_base 11 mod_base OTHER note abasic site source 1..18 mol_type genomic DNA organism Homo sapiens gagcattgacntaaggct 30 DNA PAT modified_base 1..30 mod_base OTHER note 2,3-dihydroxypropyl nucleosides (glycol nucleic acids) source 1..30 mol_type other DNA organism synthetic construct note GNA sequence tagttcattgactaaggctccccattgact 10 DNA PAT misc_difference 10 note Position is optional but preferably g source 1..10 mol_type other DNA organism synthetic construct aatgccggag 10 DNA PAT source 1..10 mol_type other DNA organism synthetic construct aatgccggak 10 DNA PAT source 1..10 mol_type other DNA organism synthetic construct aatgccggac 10 DNA PAT source 1..10 mol_type genomic DNA organism Homo sapiens aatgttggac 15 DNA PAT source 1..15 mol_type other DNA organism synthetic construct nngkngkngkagvcr 7 AA PAT VARIANT 1 note X can be any amino acid source 1..7 mol_type protein organism Homo sapiens XYEKGJL 30 DNA PAT misc_feature 1 note This sequence is one of four branches of a branched polynucleotide source 1..30 mol_type other DNA organism synthetic construct cacacaaaaaaaaaaaaaaaaaaaaaaaaa 28 DNA PAT misc_feature 1 note This sequence is one of four branches of a branched polynucleotide. source 1..28 mol_type other DNA organism synthetic construct cacataggcatctcctagtgcaggaaga 75 RNA PAT modified_base 39 mod_base p modified_base 54 mod_base p source 1..75 mol_type tRNA organism Homo sapiens gcggatttagctcagctgggagagcgccagactgaatanctggagtcctgtgtncgatccacagaattcgcacca 44 DNA PAT source 1..44 mol_type genomic DNA organism Homo sapiens gatcattttttatattttttatattttttatattttttatgtac 44 DNA PAT repeat_region 5..40 rpt_unit_seq atacgcact rpt_type tandem source 1..44 mol_type genomic DNA organism Homo sapiens attcatacgcactatacgcactatacgcactatacgcactgtac 44 DNA PAT repeat_region 5..40 rpt_type tandem rpt_unit_seq atacgcact source 1..44 mol_type genomic DNA organism Homo sapiens gatcatacgcactatacgcactatacgcactatacgcactgtac 000 74 AA PAT VARIANT 1..8 note X can be any amino acid VARIANT 10..19 note X can be any amino acid VARIANT 21..48 note X can be any amino acid VARIANT 50..68 note X can be any amino acid VARIANT 70..74 note X can be any amino acid source 1..74 mol_type protein organism synthetic construct XXXXXXXXDXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXXXXXXXXXXXXXXXXGXXXXX 4 AA PAT SITE 4 note Leu is linked to another sequence SITE 1..4 note This sequence is one part of a branched amino acid sequence source 1..4 mol_type protein organism synthetic construct RISL 4 AA PAT SITE 3 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 4 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 1..4 note This sequence is one part of a branched amino acid sequence source 1..4 mol_type protein organism synthetic construct LLKK 6 AA PAT SITE 6 note Ala is linked to another sequence SITE 1..6 note This sequence is one part of a branched amino acid sequence source 1..6 mol_type protein organism synthetic construct IPACTA 6 AA PAT SITE 6 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 1..6 note This sequence is one part of a branched amino acid sequence source 1..6 mol_type protein organism synthetic construct FRAGGK 5 AA PAT SITE 5 note Ala is linked to another sequence SITE 1..5 note This sequence is one part of a branched amino acid sequence source 1..5 mol_type protein organism synthetic construct HQYFA 8 AA PAT SITE 5 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 6 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 7 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 1..8 note This sequence is one part of a branched amino acid sequence source 1..8 mol_type protein organism synthetic construct ATFGKKKA 8 AA PAT SITE 5 note The side chain of Lysine is linked via an amide linkage to another sequence source 1..8 mol_type protein organism Homo sapiens DGSAKKKK 5 AA PAT SITE 5 note Gly is linked to another sequence source 1..5 mol_type protein organism Homo sapiens AASHG 13 DNA PAT source 1..13 mol_type genomic DNA organism Homo sapiens atcgcaattggcc 13 DNA PAT source 1..13 mol_type genomic DNA organism Homo sapiens ggccaattgcgat 58 DNA PAT source 1..58 mol_type genomic DNA organism Homo sapiens tagttcattgactaaggctccccattgactaaggcgactagcattgactaaggcaagc 16 DNA PAT modified_base 6 mod_base OTHER note N-(2-aminoethyl) glycine 5-nitroindole or N-(2-aminoethyl) glycine 3-nitroindole modified_base 1..16 mod_base OTHER note N-(2-aminoethyl) glycine nucleosides (PNA) source 1..16 mol_type other DNA organism synthetic construct cgcctnagtcaatggg 25 DNA PAT source 1..25 mol_type genomic DNA organism Homo sapiens atcgggatcgcatattcgattggcc 25 DNA PAT source 1..25 mol_type genomic DNA organism Homo sapiens ggccaatatggcttgcgatcccgat 20 RNA PAT modified_base 1 mod_base OTHER note thymine misc_feature 1 note The 5' phosphate of the thymidine is attached through the linker 3-hydroxybenzamido-N-propyl-3-phosphate to ccugucgt source 1..20 mol_type other RNA organism synthetic construct tcctgtccggagatgttgat 8 AA PAT VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid source 1..8 mol_type protein organism Homo sapiens GGGXGGGX 400 AA PAT VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid VARIANT 12 note X can be any amino acid VARIANT 16 note X can be any amino acid VARIANT 20 note X can be any amino acid VARIANT 24 note X can be any amino acid VARIANT 28 note X can be any amino acid VARIANT 32 note X can be any amino acid VARIANT 36 note X can be any amino acid VARIANT 40 note X can be any amino acid VARIANT 44 note X can be any amino acid VARIANT 48 note X can be any amino acid VARIANT 52 note X can be any amino acid VARIANT 56 note X can be any amino acid VARIANT 60 note X can be any amino acid VARIANT 64 note X can be any amino acid VARIANT 68 note X can be any amino acid VARIANT 72 note X can be any amino acid VARIANT 76 note X can be any amino acid VARIANT 80 note X can be any amino acid VARIANT 84 note X can be any amino acid VARIANT 88 note X can be any amino acid VARIANT 92 note X can be any amino acid VARIANT 96 note X can be any amino acid VARIANT 100 note X can be any amino acid VARIANT 104 note X can be any amino acid VARIANT 108 note X can be any amino acid VARIANT 112 note X can be any amino acid VARIANT 116 note X can be any amino acid VARIANT 120 note X can be any amino acid VARIANT 124 note X can be any amino acid VARIANT 128 note X can be any amino acid VARIANT 132 note X can be any amino acid VARIANT 136 note X can be any amino acid VARIANT 140 note X can be any amino acid VARIANT 144 note X can be any amino acid VARIANT 148 note X can be any amino acid VARIANT 152 note X can be any amino acid VARIANT 156 note X can be any amino acid VARIANT 160 note X can be any amino acid VARIANT 164 note X can be any amino acid VARIANT 168 note X can be any amino acid VARIANT 172 note X can be any amino acid VARIANT 176 note X can be any amino acid VARIANT 180 note X can be any amino acid VARIANT 184 note X can be any amino acid VARIANT 188 note X can be any amino acid VARIANT 192 note X can be any amino acid VARIANT 196 note X can be any amino acid VARIANT 200 note X can be any amino acid VARIANT 204 note X can be any amino acid VARIANT 208 note X can be any amino acid VARIANT 212 note X can be any amino acid VARIANT 216 note X can be any amino acid VARIANT 220 note X can be any amino acid VARIANT 224 note X can be any amino acid VARIANT 228 note X can be any amino acid VARIANT 232 note X can be any amino acid VARIANT 236 note X can be any amino acid VARIANT 240 note X can be any amino acid VARIANT 244 note X can be any amino acid VARIANT 248 note X can be any amino acid VARIANT 252 note X can be any amino acid VARIANT 256 note X can be any amino acid VARIANT 260 note X can be any amino acid VARIANT 264 note X can be any amino acid VARIANT 268 note X can be any amino acid VARIANT 272 note X can be any amino acid VARIANT 276 note X can be any amino acid VARIANT 280 note X can be any amino acid VARIANT 284 note X can be any amino acid VARIANT 288 note X can be any amino acid VARIANT 292 note X can be any amino acid VARIANT 296 note X can be any amino acid VARIANT 300 note X can be any amino acid VARIANT 304 note X can be any amino acid VARIANT 308 note X can be any amino acid VARIANT 312 note X can be any amino acid VARIANT 316 note X can be any amino acid VARIANT 320 note X can be any amino acid VARIANT 324 note X can be any amino acid VARIANT 328 note X can be any amino acid VARIANT 332 note X can be any amino acid VARIANT 336 note X can be any amino acid VARIANT 340 note X can be any amino acid VARIANT 344 note X can be any amino acid VARIANT 348 note X can be any amino acid VARIANT 352 note X can be any amino acid VARIANT 356 note X can be any amino acid VARIANT 360 note X can be any amino acid VARIANT 364 note X can be any amino acid VARIANT 368 note X can be any amino acid VARIANT 372 note X can be any amino acid VARIANT 376 note X can be any amino acid VARIANT 380 note X can be any amino acid VARIANT 384 note X can be any amino acid VARIANT 388 note X can be any amino acid VARIANT 392 note X can be any amino acid VARIANT 396 note X can be any amino acid VARIANT 400 note X can be any amino acid VARIANT 4..400 note X can be any amino acid VARIANT 9..400 note Up to 98 copies of GGGX can be deleted source 1..400 mol_type protein organism synthetic construct GGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGX 000 8 AA PAT VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid source 1..8 mol_type protein organism Homo sapiens GGGXGGGX 12 AA PAT VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid VARIANT 12 note X can be any amino acid source 1..12 mol_type protein organism Homo sapiens GGGXGGGXGGGX 333 DNA PAT CDS 19..114 protein_id 47 translation MAPNTQTASPRALADSLMQLARQVSRLESGQ CDS 115..222 protein_id 48 translation MTMITDSLAVVLQRRDWENPGVTQLNRLAAHWCQK CDS 251..283 protein_id 49 translation MLRRQVNEVA source 1..333 mol_type genomic DNA organism Homo sapiens caattcagggtggtgaatatggcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggccaggcaggtgagcaggctggaaagcgggcagtgaatgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaacttaatcgccttgcagcacattggtgtcaaaaataataataaccggatgtactatttatccctgatgctgcgtcgtcaggtgaatgaagtcgcttaagcaatcaatgtcggatgcggcgcgacgcttatccgaccaacatatcataa 31 AA PAT source 1..31 mol_type protein organism Homo sapiens MAPNTQTASPRALADSLMQLARQVSRLESGQ 35 AA PAT source 1..35 mol_type protein organism Homo sapiens MTMITDSLAVVLQRRDWENPGVTQLNRLAAHWCQK 10 AA PAT source 1..10 mol_type protein organism Homo sapiens MLRRQVNEVA 10 AA PAT SITE 2 note Homoserine VARIANT 3..6 note A or G source 1..10 mol_type protein organism synthetic construct AXXXXXYLGS 10 AA PAT MOD_RES 2 note Hyl SITE 7 note Nle SITE 10 note Orn source 1..10 mol_type protein organism synthetic construct AKYLGSXVSX 17 AA PAT DISULFID 4..15 note intrachain disulfide bond CARBOHYD 9 note Asn side-chain N-linked to asialyloligosaccharide source 1..17 mol_type protein organism Homo sapiens LEYCLKRWNETISHCAW 106 AA PAT source 1..106 mol_type protein organism synthetic construct LLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYMR 53 AA PAT VARIANT 2..3 note X can be any amino acid VARIANT 5..24 note X can be any amino acid VARIANT 26..28 note X can be any amino acid VARIANT 30 note deleted VARIANT 30..49 note X can be any amino acid VARIANT 51..52 note X can be any amino acid source 1..53 mol_type protein organism synthetic construct KXXKXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXXKXXK 52 AA PAT VARIANT 2..3 note X can be any amino acid VARIANT 5..24 note X can be any amino acid VARIANT 26..28 note X can be any amino acid VARIANT 29..30 note X is inserted VARIANT 30..48 note X can be any amino acid VARIANT 50..51 note X can be any amino acid source 1..52 mol_type protein organism synthetic construct KXXKXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXKXXK 63 AA PAT VARIANT 2..3 note X can be any amino acid VARIANT 5..29 note X can be any amino acid; up to 10 residues may be deleted VARIANT 31..33 note X can be any amino acid VARIANT 35..59 note X can be any amino acid; up to 10 residues may be deleted VARIANT 61..62 note X can be any amino acid source 1..63 mol_type protein organism synthetic construct KXXKXXXXXXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXXXXXXXKXXK 43 AA PAT VARIANT 2..3 note X can be any amino acid VARIANT 5..19 note X can be any amino acid; up to 10 X residues may be inserted VARIANT 21..23 note X can be any amino acid VARIANT 25..39 note X can be any amino acid; up to 10 X residues may be inserted VARIANT 41..42 note X can be any amino acid source 1..43 mol_type protein organism synthetic construct KXXKXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXKXXK 6 AA PAT SITE 1 note This residue is linked N-terminally to a peptide having an N-terminal Gly-Gly and a gap of undefined length VARIANT 5..6 note X can be any amino acid source 1..6 mol_type protein organism synthetic construct GGAGXX 45 DNA PAT CDS 1..45 translation MTGNKPETDVYEIL protein_id 60 source 1..45 mol_type genomic DNA organism Homo sapiens atgaccggaaataaacctgaaaccgatgtttacgaaattttatga 14 AA PAT source 1..14 mol_type protein organism Homo sapiens MTGNKPETDVYEIL 22 DNA PAT source 1..22 mol_type genomic DNA organism Drosophila melanogaster acattgaatctcataccacttt 19 DNA PAT source 1..19 mol_type genomic DNA organism Drosophila virilis acatggatcccacgacttt 22 DNA PAT source 1..22 mol_type genomic DNA organism Drosophila simulans gtatggcgtcgtatsgtagttt 7 AA PAT VARIANT 7 note X is S or T source 1..7 mol_type protein organism Homo sapiens GGGJATX 7 AA PAT VARIANT 4 note replace with I VARIANT 7 note replace with T source 1..7 mol_type protein organism Homo sapiens GGGLATS 7 AA PAT VARIANT 4 note X can be any amino acid source 1..7 mol_type protein organism Homo sapiens GLPXRIC 7 AA PAT source 1..7 mol_type protein organism Homo sapiens GLPVRIC 7 AA PAT source 1..7 mol_type protein organism Homo sapiens GLPTRIC 7 AA PAT source 1..7 mol_type protein organism Homo sapiens GLPDRIC 36 DNA PAT source 1..36 mol_type genomic DNA organism Homo sapiens cgaatgncccactacgaatgncacgaatgncccaca 36 DNA PAT source 1..36 mol_type genomic DNA organism Homo sapiens cgaatgacccactacgaatgbcacgaatgbcccaca 36 DNA PAT source 1..36 mol_type genomic DNA organism Homo sapiens cgaatgtcccactacgaatgvcacgaatgvcccaca 36 DNA PAT source 1..36 mol_type genomic DNA organism Homo sapiens cgaatggcccactacgaatghcacgaatghcccaca 36 DNA PAT source 1..36 mol_type genomic DNA organism Homo sapiens cgaatgccccactacgaatgdcacgaatgdcccaca 400 DNA PAT CDS join(1..79,142..212,272..400) protein_id 76 translation MKTFAALLSAVTLALSVRAQAAVWSQCGGTPGWTGETTCVAGSVCTSLSSSYSQCVPGSATSSAPAAPSATTSGPAPTDGTCSASGAWPPLT source 1..400 mol_type genomic DNA organism Homo sapiens atgaagactttcgcagccttgctttccgctgtcactctcgcgctctcggtgcgcgcccaggcggctgtctggagtcaatgtaagtgccgctgcttttcattgatacgagactctacgccgagctgacgtgctaccgtataggtggcggtacaccgggttggacgggcgagaccacttgcgttgctggttcggtttgtacctccttgagctcagtgagcgactttcaatccgtcgtcattgctcctcatgtattgacgattggccttcatagtcatactctcaatgcgttccgggctccgcaacgtccagcgctccggcggccccctcagcgacaacttcaggccccgcacctacggacggaacgtgctcggccagcggggcatggccgccattgacctga 92 AA PAT source 1..92 mol_type protein organism Homo sapiens MKTFAALLSAVTLALSVRAQAAVWSQCGGTPGWTGETTCVAGSVCTSLSSSYSQCVPGSATSSAPAAPSATTSGPAPTDGTCSASGAWPPLT 9 AA PAT source 1..9 mol_type protein organism Homo sapiens AVLTYLRGE 9 AA PAT source 1..9 mol_type protein organism Homo sapiens AVLTYLRGA 9 AA PAT source 1..9 mol_type protein organism Homo sapiens AVPTYPRGE 9 AA PAT source 1..9 mol_type protein organism Homo sapiens AVAIGYRGE 8 AA PAT source 1..8 mol_type protein organism Homo sapiens AVLTYLGE 32 AA PAT VARIANT 4 note N or T VARIANT 11 note A or T VARIANT 12 note K or Q VARIANT 18 note K or Q or N or D VARIANT 21 note R or G VARIANT 22 note K or I or N VARIANT 24 note L or V VARIANT 29 note M or L source 1..32 mol_type protein organism synthetic construct LEGXEQFINAXXIIRHPXYBXXTXBNDIXLIK 32 AA PAT source 1..32 mol_type protein organism Homo sapiens LEGNEQFINAAKIIRHPQYDRKTLNNDIMLIK 32 AA PAT source 1..32 mol_type protein organism Pongo abelii LEGNEQFINAAKIIRHPQYDRKTVNNDIMLIK 32 AA PAT source 1..32 mol_type protein organism Papio anubis LEGTEQFINAAKIIRHPDYDRKTLNNDILLIK 32 AA PAT source 1..32 mol_type protein organism Rhinopithecus roxellana LEGTEQFINAAKIIRHPNYNRITLDNDILLIK 32 AA PAT source 1..32 mol_type protein organism Pan paniscus LEGNEQFINAAKIIRHPKYNRITLNNDIMLIK 32 AA PAT source 1..32 mol_type protein organism Rhinopithecus bieti LEGNEQFINATKIIRHPKYNGNTLNNDIMLIK 32 AA PAT source 1..32 mol_type protein organism Rhinopithecus roxellana LEGNEQFINATQIIRHPKYNGNTLNNDIMLIK 7 AA PAT SITE 6 note Lys side chain links to the tripeptide ALE SITE 1..7 note Cysteine Leucine thioester (Cys-Leu) source 1..7 mol_type protein organism synthetic construct CALRDKL 5 AA PAT SITE 5 note Ser is linked to another sequence through an amide linkage between Ser and a side chain of a Lys in the other sequence source 1..5 mol_type protein organism synthetic construct LRDQS 6 AA PAT SITE 4 note The side chain of Lys is linked via an amide linkage to another sequence REGION 1..6 note Circular peptide source 1..6 mol_type protein organism synthetic construct ALFKNG 43 DNA PAT misc_feature 43 note DNA fragment misc_feature 1..7 note DNA fragment misc_feature 8..42 note RNA fragment source 1..43 mol_type other DNA organism synthetic construct agaccttcggagtctcctgttgaacagatagtcaaagtagatc 216 DNA PAT CDS <1..>216 protein_id 95 translation HHAAECGFCPQQWQVLRGSLCICEGPAEGWFISRCWLWCGPQVQGFIFGEGKEGGGDRRAEASPQEFWECTW source 1..216 mol_type genomic DNA organism Homo sapiens catcacgcagcagaatgtggattttgtcctcaacaatggcaagttctacgtgggagtctgtgcatttgtgagggtccagctgaaggatggttcatatcaagatgttggttatggtgtgggcctcaagtccaaggctttatctttggagaaggcaaggaaggaggcggtgacagacgggctgaagcgagccctcaggagttttgggaatgcacttgg 72 AA PAT source 1..72 mol_type protein organism Homo sapiens HHAAECGFCPQQWQVLRGSLCICEGPAEGWFISRCWLWCGPQVQGFIFGEGKEGGGDRRAEASPQEFWECTW 17 AA PAT VARIANT 9 note Ile, Ala, Phe, Tyr, aIle, MeIle, or Nle source 1..17 mol_type protein organism Homo sapiens LEYCLKRWXETISHCAW 13 AA PAT MOD_RES 7 note Arginine is deiminated to form citrulline source 1..13 mol_type protein organism Homo sapiens LEYCLKRWETISH 212 DNA PAT misc_feature 212^1 note The molecule is circular source 1..212 mol_type other DNA organism Homo sapiens atggataatgaagaagttaacgaagaatgtatgagattatttttcaagaacgctcgtgcgcatctggataaacatctaacatcaaggttgacatgcgatgaaaatgaaaatgcatatatcacgttcagatgcttcctggatggaatacatcgcaaatctactaggtttctcgaagagctacttttgaaacaagaaaatatgtaccaccaatg 12 DNA PAT misc_feature 12 note This residue is connected to an inverted nucleotide sequence through a 3'-3' phosphodiester bond to a thymidine 3'-monophosphate at position 13 of the sequence tcagttacccctt source 1..12 mol_type other DNA organism synthetic construct attgactaagtg 13 DNA PAT misc_feature 13 note This residue is connected to an inverted nucleotide sequence through a 3'-3' phosphodiester bond to a guanosine 3'-monophosphate at position 12 of sequence attgactaagtg source 1..13 mol_type other DNA organism synthetic construct tcagttacccctt 13 DNA PAT misc_feature 13 note This residue is connected via a 3'-3'-phosphodiester bond to a thymidine 3'-monophosphate that is in turn connected via a 5'-5'-phosphodiester bond to the g residue at position 1 of the sequence gcccattgact source 1..13 mol_type other DNA organism synthetic construct attgactaagtgc 11 DNA PAT misc_feature 1 note This residue is connected via a 5'-5' phosphodiester bond to a thymidine 3'-monophosphate that is in turn connected via a 3'-3' phosphodiester bond to the c residue at position 13 of the sequence attgactaagtgc source 1..11 mol_type other DNA organism synthetic construct gcccattgact 8 AA PAT SITE 7 note 4-aminobenzoic acid source 1..8 mol_type protein organism synthetic construct MLAFYGXY 10 DNA PAT source 1..10 mol_type other DNA organism synthetic construct nngkngkngk 10 DNA PAT misc_feature 10 note n can be any nucleotide, preferably g, k or c source 1..10 mol_type other DNA organism synthetic construct aatgccggan 8 DNA PAT misc_feature 1..8 note This segment is modified at the 5' end and/or the 3' end by "pnp" and connected together as part of a larger branched structure source 1..8 mol_type other DNA organism synthetic construct acacacac 6 DNA PAT misc_feature 1..6 note This segment is modified at the 5' end and/or the 3' end by "pnp" and connected together as part of a larger branched structure source 1..6 mol_type other DNA organism synthetic construct acacac 2 DNA PAT misc_feature 1..2 note This segment is modified at the 5' end and/or the 3' end by "pnp" and connected together as part of a larger branched structure source 1..2 mol_type other DNA organism synthetic construct ac 12 DNA PAT misc_difference 5..8 note n is adenine, inosine or pseudoiuridine modified_base 5..8 mod_base OTHER note i note p source 1..12 mol_type other DNA organism synthetic construct gatcnnnngtac 3 AA PAT SITE 3 note Ala is linked to another sequence SITE 1..3 note This sequence is one part of a branched amino acid sequence source 1..3 mol_type protein organism synthetic construct YFA 3 AA PAT SITE 3 note The lysine is linked via an amide linkage to another sequence SITE 1..3 note This sequence is one part of a branched amino acid sequence source 1..3 mol_type protein organism synthetic construct LLK 3 AA PAT SITE 3 note Attached to the lysine residue at position 6 of the cyclic peptide CALRDKL source 1..3 mol_type protein organism synthetic construct ALE 8 RNA PAT modified_base 8 mod_base OTHER note thymine misc_feature 8 note The 3' end of the sequence is attached through the linker 3-hydroxybenzamido-N-propyl-3- phosphate to the 5' end of the sequence tccuguccggagauguugau source 1..8 mol_type other RNA organism synthetic construct cctgtcgt 5 AA PAT SITE 1 note N-(sulfanylmethyl)glycine SITE 2 note N-(1H-indol-3-ylmethyl)glycine SITE 3 note N-(isobutyl)glycine SITE 4 note N-(aminobutyl)glycine SITE 5 note N-(hydroxymethyl)glycine source 1..5 mol_type protein organism synthetic construct CWLKS 6 AA PAT SITE 1 note N-(4-aminobutyl)glycine SITE 2 note N-(benzyl)glycine SITE 3 note N-(4-hydroxybutyl)glycine SITE 4 note N-(butyl)glycine SITE 5 note 2-aminocyclobutane-1-carboxylic acid SITE 6 note N-[1-(indol-3-yl)methyl]glycine source 1..6 mol_type protein organism synthetic construct KFXXKW 11 AA PAT source 1..11 mol_type protein organism synthetic construct KKLLKLLKLLL 11 AA PAT SITE 2 note N-(4-aminobutyl)glycine SITE 4 note N-(isobutyl)glycine SITE 6 note N-(isobutyl)glycine SITE 8 note N-(4-aminobutyl)glycine SITE 10 note N-(isobutyl)glycine source 1..11 mol_type protein organism synthetic construct KKLLKLLKLLL 4 AA PAT VARIANT 4 note X can be any amino acid source 1..4 mol_type protein organism synthetic construct GGGX 5 AA PAT SITE 1 note 3,7-diaminoheptanoic acid SITE 2 note 3-amino-4-phenylbutanoic acid SITE 3 note 3-amino-2-(hydroxymethyl)propanoic acid SITE 4 note 3-amino-2-methylpropanoic acid SITE 5 note 2-aminocyclobutane-1-carboxylic acid source 1..5 mol_type protein organism synthetic construct KFSAX 2 AA PAT SITE 2 note C-terminal residue is linked to the N-terminal residue of the sequence GGXX by a gap of an undefined length source 1..2 mol_type protein organism synthetic construct GG 4 AA PAT SITE 1 note N-terminal residue is linked to the C-terminal residue of the sequence GG by a gap of an undefined length source 1..4 mol_type protein organism synthetic construct GGXX 2 AA PAT SITE 2 note C-terminal residue is linked to a peptide of unknown length and sequence, which is in turn linked to the N-terminal residue of the peptide GGAGXX source 1..2 mol_type protein organism synthetic construct GG