Décisions: D2018-1800 - D2018-1999

Pour plus de détails concernant une décision particulière de la commission administrative, veuillez vous adresser à un membre du personnel du centre.

Dernière actualisation: 22 sept. 2019

Numéro du litige Requérant Défendeur Nom(s) de domaine Décision
D2018-1800Beymen Maǧazacılık Anonim Şirketi-beymenyapi.comClassé
D2018-1801Dunder Limited-dunderfun.comClassé
D2018-1802Belfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkersbelfius.appTransfert
D2018-1803ProjectClubPrivacy Protection / Alesandr Pilschikoveasybreath.websiteTransfert
D2018-1804Rockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Millsrockefellerqroup.comTransfert
D2018-1805American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Laylaamericanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
Transfert
D2018-1806Multi Media, LLCWhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasyachatur2018.comTransfert
D2018-1807LinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metricsbuylinkedinfollowers.comTransfert
D2018-1808Asianet Satellite Communications LimitedFuture Media Architects Inc.asianet.netPlainte rejetée
D2018-1809InterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltdgoindigo.comTransfert
D2018-1810Navasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko 1xbet.dateTransfert
D2018-1811Crédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexiscic-mon-compte.reviewTransfert
D2018-1812Tang Frerestang frerestangfreres.onlineTransfert
D2018-1813Alain Afflelou Franchiseur-afflelou3d.comClassé
D2018-1814Kiko Technology LimitedRobert Gibellinikikotechnology.comTransfert
D2018-1815HID Global CorporationJohn Makinwahidqlobal.comTransfert
D2018-1816Childrens Outlet LtdIan Davidson, Childrensalon Ltdchildrensoutlet.comTransfert
D2018-1817ArcelorMittal (SA)zhou zhou, zhou zhouarcelormittal.topTransfert
D2018-1818Confederation Nationale Du Credit MutuelDavid Leparouxcreditmutuel.companyTransfert
D2018-1819Mr BricolageWhoisGuard, Inc. / Alexandre Noffymr-bricolage.onlineTransfert
D2018-1820AB Electrolux-zanussi.online
zanussi.site
Classé
D2018-1821Laboratoires Thea-blephacleanse.comClassé
D2018-1822AB ElectroluxRajaa Nasrzanussi.clickTransfert
D2018-1823AB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.zanussi.expertTransfert
D2018-1824Inter-Continental Hotels Corporationnibah perfect fondikumintercontinentalhotelaustin.comTransfert
D2018-1825Expensify, Inc.-expensifysupport.comClassé
D2018-1826Roland Szegi-airvape.comClassé
D2018-1827Oanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatteroandaxmtrade.comTransfert
D2018-1828iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.buy-duromine.com
cheapduromine.com
Transfert
D2018-1829SAP SESwarup Choudhurisaphanatutorial.comTransfert
D2018-1830Allianz SEInnokentiy Maskileysonallianz.travelTransfert
D2018-1831The Brighton and Hove Albion Football Club LimitedMr. Dave Bantockbrightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
Transfert
D2018-1832Boyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boynersboynerler.comPlainte rejetée
D2018-1833Implantcast GmbHBeatsimplantcast.comTransfert
D2018-1834BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
Transfert
D2018-1835Households & Toiletries Manufacturing Co. Ltd.Kawar, Fathi, El-Maydan Co. Oil Fields Supplyhigeen.comPlainte rejetée
D2018-1836iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescubuyduromineonline.com
duromineonline.com
Transfert
D2018-1837New York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.nycifgroup.comTransfert
D2018-1838The Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise fdmag.comTransfert
D2018-1839Ford Motor CompanyAdvert Onlinelincolnnavigator.comTransfert
D2018-1840Bayer AG-boycottbayer.comClassé
D2018-1841Bayer AGRegistration Private, Domains By Proxy, LLC. / Elizabeth Hulbertbayernow.comTransfert
D2018-1842Philip Morris Products S.A.Liudinghongbestiqos.comTransfert
D2018-1843Arcelormittal S.A.-tjarcelormittal.comClassé
D2018-1844Confederation Nationale du Credit MutuelMalo Corentinecredit-mutuel.techTransfert
D2018-1845Caterpillar Inc.Sara Alaouicatindustrie.com
catmarbre.com
Transfert
D2018-1846OSRAM GmbHyue tang, tangyueosramd.comTransfert
D2018-1847PROXIMUS, NV van publiek rechtWang Xiao Qin proximus.techTransfert
D2018-1848Star Stable Entertainment ABDawid Olszewskistarstable-hack.winTransfert
D2018-1849Tenaris Connections BVDomain Admin, HugeDomains.comtemaris.comPlainte rejetée
D2018-1850Fashionphile, LLC-fashionphileoutlet.comClassé
D2018-1851Gerben Law Firm, PLLCWhois Privacy Corp.gerbentrademark.comTransfert
D2018-1852iNova Pharmaceuticals (Singapore) Pte. Limited-buyduromineonline.comClassé
D2018-1853Venus et Fleur LLCDomains by Proxy, LLC / Amanda Wojtaseternalfleur.comPlainte rejetée
D2018-1854International Business Machines Corporation-ilbm.comClassé
D2018-1855Caisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichantcredit-mutuel-confirmation-mobile.comTransfert
D2018-1856Euronext N.V.Huang tian weiaex.com
aex-global.com
aex88.com
Plainte rejetée
D2018-1857Elliott Management Corporation-elliotttmgmt.comClassé
D2018-1858California Milk Processor BoardJeff Pendleton, Harvest Properties, LLCgotmilkyet.comTransfert
D2018-1859A Medium CorporationProtection of Private Person / Yurii Selivanov medium-airdrop.com
medium-news.com
Transfert
D2018-1860A Medium CorporationMarat Mukhametmediurn.comTransfert
D2018-1861Dreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltddreamstine.comTransfert
D2018-1862Multi Media, LLCRegistration Private, Domains By Proxy, LLC / Apetre Andreifreetokenschaturbate.comTransfert
D2018-1863LEGO Juris A/S (乐高博士有限公司)Xu Yin Liangnmglego.comTransfert
D2018-1864Philip Morris USA Inc.-phillpmorris.comClassé
D2018-1865Medical Marijuana, Inc.Domains By Proxy, LLC / Michael Wigtoncbdhempmeds.netRejet avec opinion concordante
D2018-1866Pro Se Planning, Inc. dba DivorcewriterRegistration Private, Domains By Proxy, LLC / Bogdanov Andriydivorcepaperswriter.comTransfert
D2018-1867Ubiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolleunifi-ip.comTransfert
D2018-1868Philip Morris Products S.A.Kostas Martakisiqos-plus.comTransfert
D2018-1869Philip Morris Products S.A.Yang Jiang Naniqos456.comTransfert
D2018-1870NXP B.V.Ershov Dmitriimifare.shop
mifare.store
Transfert
D2018-1871Confederation Nationale du Credit MutuelGARR Garderiemutuelcreditinvest.comTransfert
D2018-1872Philip Morris Products S.A.-blackiqos.comClassé
D2018-1873Philip Morris Products S.A.Yuksel Kambaliqosmy.net
iqosmy.org
Transfert
D2018-1874Project Management Institute, Inc.Privacy Protect, LLC / Herr Thomas Henkpmiukraine.orgTransfert
D2018-1875Valero Energy Corporation
Valero Marketing and Supply Company
Lacey Larsenvalero.vipTransfert
D2018-1876Bartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Bradybartec.comTransfert
D2018-1877Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
Artur Hasamov
Artur Hasamov, Private Person
Gustavo Frings
Moniker Privacy Services
moniker.com, Moniker Online Services, LLC
Oleksandr Nikolaienko
Protection of Private Person
newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Transfert
D2018-1878Robertet SAMarie Claude Hollerfr-robertet.comTransfert
D2018-1879Philip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalayiqosturk.comTransfert
D2018-1880Ally Financial Inc.Zhao Hongallybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Transfert
D2018-1881The Capital Group Companies, Inc.Crystal Marie, Savoy Partners London
Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London
capgroupco.com
thecapitalgroupco.com
Transfert
D2018-1882Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Projecthotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Transfert
D2018-1883Breitling SAManoj Kumar Alwanibreitlingboutique.com
breitlingshop.com
breitlingstore.com
Transfert
D2018-1884The Depository Trust & Clearing CorporationName Redacteddtccglobal.comTransfert
D2018-1885Pezo Tech LLCPerfect Privacy, LLC / Mihalis Pourgourispezo.comPlainte rejetée
D2018-1886Accenture Global Services LimitedDomain eRegistrationaccentureplacement.comTransfert
D2018-1887Ford Motor CompanyWhois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Companyspradleyford.comTransfert
D2018-1888Brambles Ltd.WhoisGuard Protected / Emimimo Steven / avoca davis chep-uk.com
chep-us.com
Transfert
D2018-1889Hunt Family Properties, LLCLarry Lee, Phoenix Success Systemshuntbrotherspizza.onlineTransfert
D2018-1890Dreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltddreamstimes.comTransfert
D2018-1891Mou LimitedDomain Admin Privacy Protect, LLC (PrivacyProtect.org)
Luo Yuandong, Laoyuandong
Song Li Hong
Sun YanQi
Whois Agent, Domain Whois Privacy Protection Service
mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Transfert
D2018-1892M&G LimitedSmith Taylormandginvestment.comTransfert
D2018-1893Valeant Pharmaceuticals Ireland LimitedDomains By Proxy, LLC / Micro Duobri,New Micro Ageduobrii.comTransfert
D2018-1894Halfords Limited-halfordsgroup.comClassé
D2018-1895Future Motion, Inc.Nexperian Holding Limited / Duke Chow, Dukeonewheel-hoverboard.comTransfert
D2018-1896Social Capital Markets LLCDomains By Proxy, LLC / victor gillsocap2018.orgPlainte rejetée
D2018-1897Gap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell secure-gap.comTransfert
D2018-1898BouyguesNom anonymisébouygues-services.comTransfert
D2018-1899Dreamstime.com, LLCSapphire Brands, Sapphire Brands Limiteddreamtimes.comPlainte rejetée
D2018-1900Cassiopea S.p.A.-breezula.com
winlevi.com
Classé
D2018-1901Palumbo Services, Inc.kyle Brink, Brink Roofingerieicedamremovalguys.comRadiation
D2018-1902Joran LundhPRIVACYDOTLINK Customer 2898984 / Stanley Pacelascal.comTransfert
D2018-1903Valero Energy Corporation
Valero Marketing and Supply Company
Riaat Bennvalero-usa.comTransfert
D2018-1904Johnson Controls Hybrid and Recycling GmbHWang Jian Huavarta-automotlve.comTransfert
D2018-1905Montar A/SDomain Administrator, NameFind LLCmontar.comPlainte rejetée
D2018-1906Robert Bosch GmbHMaxim SPD CHervinchukbosch-ua.comTransfert
D2018-1907Marlette Funding, LLCWhois Privacy Corpbesteggloansreviews.comTransfert
D2018-1908Advance Magazine Publishers Inc.Robert McDonoughgqme.comPlainte rejetée
D2018-1909TMF Group B.V.Contact Privacy Inc. Customer 1242811003 / The Dovetail Agencytmf-gronp.comTransfert
D2018-1910Kings Landing LimitedName Redactedjaegerdressessale.comTransfert
D2018-1911Virgin Enterprises LimitedZanta Consultvirginluxuryhotels.comTransfert
D2018-1912DecathlonBill Wangdecathlon-sa.comTransfert
D2018-1913Rexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durandgrouperexel.comTransfert
D2018-1914Crédit industriel et commercial S.A.-cic-admin.comClassé
D2018-1915S.L.E. Service aux Loteries en EuropeSuper Privacy Service Ltd. c/o Dynadotlotoeuromillions.comTransfert
D2018-1916S.L.E. Service aux Loteries en EuropeAlbert Rajalaloto-euro-millions-jackpot.comTransfert
D2018-1917S.L.E. Service aux Loteries en EuropeSteve Patton, Data Download euromillions-lotto.netTransfert
D2018-191882 s.r.l.Chris Grivaspiombo.comPlainte rejetée
D2018-1919ICC Business Corporation FZ LLCShashank Sharmat20worldcup.comTransfert
D2018-1920International Business Machines CorporationWhoisGuard Protected / Richard Andersonforeverloveibm.comTransfert
D2018-1921International Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchangeibmmonitors.netTransfert
D2018-1922Kraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltdkraftheinzcornpany.comTransfert
D2018-1923Ford Motor CompanyCustomer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. lincolnnavigator.orgTransfert
D2018-1924LEGO Juris A/SAdmin Contact, PrivateName Services Inc. / Rey Leandelegoland-danmark.comTransfert
D2018-1925Frey Wille GmbH & Co. KGKabir S Rawatfreywille.orgTransfert
D2018-1926Banco Inter S.A.Anderson Santos, leaodechacara.combancointer.appTransfert
D2018-1927Klarna Bank AB-klarnabitcoin.comClassé
D2018-1928Klarna Bank ABSuper Privacy Service LTD c/o Dynadotklarnascam.comTransfert
D2018-1929LEGO Juris A/SThai Danglegoclone.comTransfert
D2018-1930Accenture Global Services LimitedDomain eRegistration, Domain eRegistration accenturejobsplacement.comTransfert
D2018-1931LEGO Juris A/S1&1 Internet Limited / Johana Juha Donadolegolandstore.comTransfert
D2018-1932腾讯控股有限公司(Tencent Holdings Limited)Lichangzhouweixinzhi.comTransfert
D2018-1933K-BOX, LLCNicole Lewis, Marketing Cohortskboxmobilestorage.comTransfert
D2018-1934Boondocker LLCRegistration Private, Domains By Proxy, LLC / Corey Bostonboondocker.comTransfert
D2018-1935Daybreak Game Company LLCLv Guo Pingmyh1z1.comTransfert
D2018-1936Philip Morris Products S.A.Jack Charlsiqoscn.netTransfert
D2018-1937L’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peterlorealfranchise.comTransfert
D2018-1938CarrefourWhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi carrefour.giftTransfert
D2018-1939Philip Morris Products S.A.Hristo Aleksandrovbgiqos.comTransfert
D2018-1940Novartis AGDomain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilaysandozmedikal.com
sandozmedikal.xyz
Transfert
D2018-1941WIPRO LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologiescareerswipro.comTransfert
D2018-19423M COMPANYLe Tan Hoa, Personalsanpham3m.comTransfert
D2018-1943Pet Plan LtdOn behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc.pet-plan-claim-form.comTransfert
D2018-1944Ground Up, Inc.DomainMarket.comgroundup.comPlainte rejetée
D2018-1945Geekway, LLCBeatsgeekway.comTransfert
D2018-1946Hiawatha National BankMartha Coehnbwi.comTransfert
D2018-1947Dental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltdpeltonandcrane.comTransfert
D2018-1948Merck KGaAYasutaka Sakatanisaizen.shopTransfert
D2018-1949CarrefourZhuhai Yingxun Keji Limited / Paul Loutin, Loutin SASbanque-carefour.com
banque-carefour.net
Transfert
D2018-1950腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yunjhbqq.comTransfert
D2018-1951Viking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
Registration Private, Domains By Proxy, LLC / Kiran Bhandarivikingcruisesindia.comTransfert
D2018-1952ZF Frledrlcbsbafen AG-zf-motoraction-rallying.comClassé
D2018-1953Skyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.skyscannerusa.comTransfert
D2018-1954Scholastic Inc.Private Registrant / Kenneth Clearyscholasticcorp.comTransfert
D2018-1955Luis StuhlbergerLaura Yun, Antarchile S.A.luisstuhlberger.comTransfert
D2018-1956Instagram, LLCInstagramBadge, LLCinstagrambadge.comTransfert
D2018-1957Groupon, Inc.Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wahgroupon.spaceTransfert
D2018-1958Legally CoDomain Administrator, Namefind LLClegally.comPlainte rejetée
D2018-1959ZB, N.A.Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronicoamegybankl.comTransfert
D2018-1960Badgley Mischka, LLCAriel Feinbadgleymischkaswim.com
badgleymischkaswimwear.com
Transfert
D2018-1961iBinder AB-ibinder.netClassé
D2018-1962Nike Innovate C.V.Li Jian Fanauthenticjordansair.comTransfert
D2018-1963腾讯控股有限公司(Tencent Holdings Limited)-weixinxinyong.comClassé
D2018-1964腾讯控股有限公司(Tencent Holdings Limited)Shixue Lianweixinjingpindian.com
weixinzhengxin.com
Transfert
D2018-1965腾讯控股有限公司(Tencent Holdings Limited)Yuan Bingnintendotencent.comTransfert
D2018-1966Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
blancpain.store
breguet.store
Transfert
D2018-1967Gap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
Domain Whois Privacy Service / Carole Poseythegapcafebar.comTransfert
D2018-1968LEGO Juris A/SMarco AntonioServin lugo, Legomexico llc
Name Redacted
Name Redacted
Name Redacted
Sagar Sunar, legokorea.llc
Wenben Zhou
legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
Transfert
D2018-1969腾讯控股有限公司(Tencent Holdings Limited)Pan She Lingwechatcredit.comTransfert
D2018-1970Crédit Industriel et Commercial S.A.-banquecic.comClassé
D2018-1971Philip Morris Products S.A.Kadir \u015eayir, Kadiriqossigarasitesi.comTransfert
D2018-1972Philip Morris Products S.A.Nguyen Minh Hoangiqos-vietnam.comTransfert
D2018-1973Shell Brands International AGJimmy Luisshellcorporate.comTransfert
D2018-1974Arcelormittal (SA)مسعود ثقفيarcelormittaliran.comTransfert
D2018-1975HARIBO GmbH & Co. KGWhois Agent, Domain Protection Services, Inc. / louane Severinsharibo-de.comRadiation
D2018-1976ArcelorMittal S.A.Ruben Gomezarcelormittal-mexico.comTransfert
D2018-1977Philip Morris Products S.A.Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov sticks-heets.comTransfert
D2018-1978DealMaker, LLCBrian Dillon-Ferrisdealmaker.comPlainte rejetée
D2018-1979Virgin Enterprises LimitedAbdab Consultvirgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Transfert
D2018-1980Williams-Sonoma, Inc.-potterybrn-shopping.worldClassé
D2018-1981LivOn Laboratories, IncMike Kearllivlabs.com
livlabsnow.com
Plainte rejetée
D2018-1982Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaewadvancefinance247.com
af247loan.com
af247offer.com
Transfert
D2018-1983Harpeth Financial Services LLC, d/b/a Advance Financial 24/7Domain Admin, Whois Privacy Corp.af247online.comTransfert
D2018-1984AB ElectroluxPetr Demidovaeg-remont.xyzTransfert
D2018-1985CarrefourContact Privacy Inc. Customer 0151522304 / lucas montanarocarrefoursecure.comTransfert
D2018-1986Société Air FranceDomain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisalairfrance-com.win
airfrancewin.win
Transfert
D2018-1987Skyscanner LimitedDomain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundationskyscannerflight.comTransfert
D2018-1988Confédération nationale du Crédit MutuelCatherine Foralicreditmutuel.expert
creditmutuel.shop
Transfert
D2018-1989Le Cordon Bleu International B.V.Gordon Blu Spolka Z Ograniczona Odpowiedzialnosciagordonblucatering.comTransfert
D2018-1990Le Cordon Bleu International B.V.Carla Rodriguescordonbleuonline.comTransfert
D2018-1991DecathlonPavel Ostapenkoarpenaz-quechua.comTransfert
D2018-1992ZipRecruiter, Inc.Cyber Domain Services Private Limited
Laksh Internet Solutions Private Limited
Postoffice Mailing Solutions Pvt. Ltd
SMVS Consultancy Private Limited
Tech Domain Services Private Limited
Web Master Internet Services Private Limited
zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
Transfert
D2018-1993Camshare, Inc.-camfrog.vipClassé
D2018-1994Accenture Global Services LimitedDomain eRegistrationaccenturerecruitment.comTransfert
D2018-1995Fusion3 Design, LLCFusion3 Inc. f/k/a TradeMark Managementfusion3.comPlainte rejetée
D2018-1996Rakuten, Inc.Registration Private, Domains By Proxy, LLC / Jack Limrakuten.appTransfert
D2018-1997Aston Martin Lagonda LimitedWhoisGuard Protected, WhoisGuard, Inc. / Sean Sterling astonmartinjp.comTransfert
D2018-1998Intuit Inc.Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTDturboxtax.comTransfert
D2018-1999Intuit Inc.Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202yurbotax.comTransfert