모든 사건: D2018-1800 - D2018-1999
최종변경일: 2024. 4. 24
사건번호 | 도메인이름 | 신청인 | 피신청인 | 절차개시일 | 사건 현황 |
---|---|---|---|---|---|
D2018-1800 | beymenyapi.com | Beymen Maǧazacılık Anonim Şirketi | - | - | 종료 |
D2018-1801 | dunderfun.com | Dunder Limited | - | - | 종료 |
D2018-1802 | belfius.app | Belfius Banque S.A./ Belfius Bank NV | Contact Privacy Inc. Customer 1242626048 / Maarten Bekkers | - | 결정 |
D2018-1803 | easybreath.website | ProjectClub | Privacy Protection / Alesandr Pilschikov | - | 결정 |
D2018-1804 | rockefellerqroup.com | Rockefeller Group International, Inc. | Registration Private, Domains By Proxy, LLC / Jason Mills | - | 결정 |
D2018-1805 | americanhomeshield.app merrymaids.app servicemaster.app terminix.app | American Home Shield Corporation ServiceMaster Brands, L.L.C. The Terminix International Company Limited Partnership | Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla | - | 결정 |
D2018-1806 | chatur2018.com | Multi Media, LLC | WhoisGuard Protected, WhoisGuard, Inc. / Ershin Vasya | - | 결정 |
D2018-1807 | buylinkedinfollowers.com | LinkedIn Corporation | Registration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics | - | 결정 |
D2018-1808 | asianet.net | Asianet Satellite Communications Limited | Future Media Architects Inc. | - | 결정 |
D2018-1809 | goindigo.com | InterGlobe Aviation Limited | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd | - | 결정 |
D2018-1810 | 1xbet.date | Navasard Limited | WhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko | - | 결정 |
D2018-1811 | cic-mon-compte.review | Crédit Industriel et Commercial | WhoisGuard, Inc. / Thierry Alexis | - | 결정 |
D2018-1812 | tangfreres.online | Tang Freres | tang freres | - | 결정 |
D2018-1813 | afflelou3d.com | Alain Afflelou Franchiseur | - | - | 종료 |
D2018-1814 | kikotechnology.com | Kiko Technology Limited | Robert Gibellini | - | 결정 |
D2018-1815 | hidqlobal.com | HID Global Corporation | John Makinwa | - | 결정 |
D2018-1816 | childrensoutlet.com | Childrens Outlet Ltd | Ian Davidson, Childrensalon Ltd | - | 결정 |
D2018-1817 | arcelormittal.top | ArcelorMittal (SA) | zhou zhou, zhou zhou | - | 결정 |
D2018-1818 | creditmutuel.company | Confederation Nationale Du Credit Mutuel | David Leparoux | - | 결정 |
D2018-1819 | mr-bricolage.online | Mr Bricolage | WhoisGuard, Inc. / Alexandre Noffy | - | 결정 |
D2018-1820 | zanussi.online zanussi.site | AB Electrolux | - | - | 종료 |
D2018-1821 | blephacleanse.com | Laboratoires Thea | - | - | 종료 |
D2018-1822 | zanussi.click | AB Electrolux | Rajaa Nasr | - | 결정 |
D2018-1823 | zanussi.expert | AB Electrolux | Privacy protection service - whoisproxy.ru / Zoom ltd. | - | 결정 |
D2018-1824 | intercontinentalhotelaustin.com | Inter-Continental Hotels Corporation | nibah perfect fondikum | - | 결정 |
D2018-1825 | expensifysupport.com | Expensify, Inc. | - | - | 종료 |
D2018-1826 | airvape.com | Roland Szegi | - | - | 종료 |
D2018-1827 | oandaxmtrade.com | Oanda Corporation | OANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter | - | 결정 |
D2018-1828 | buy-duromine.com cheapduromine.com | iNova Pharmaceuticals (Singapore) Pte. Limited | Whois Privacy Corp. | - | 결정 |
D2018-1829 | saphanatutorial.com | SAP SE | Swarup Choudhuri | - | 결정 |
D2018-1830 | allianz.travel | Allianz SE | Innokentiy Maskileyson | - | 결정 |
D2018-1831 | brightonseagulls.club brightonseagulls.com brightonseagulls.info brightonseagulls.net | The Brighton and Hove Albion Football Club Limited | Mr. Dave Bantock | - | 결정 |
D2018-1832 | boynerler.com | Boyner Büyük Mağazacılık Anonim Şirketi | Ali Boyner, Boyners | - | 결정 |
D2018-1833 | implantcast.com | Implantcast GmbH | Beats | - | 결정 |
D2018-1834 | buscemi-online.com buscemi-outlet.com buscemi-sale.com | BUSCEMI LLC | Lao Yuan Dong Whois Agent, Whois Privacy Protection Service / Chen WenTing Xinnet Whois Privacy Pro Service / Sun Yanqi | - | 결정 |
D2018-1835 | higeen.com | Households & Toiletries Manufacturing Co. Ltd. | Kawar, Fathi, El-Maydan Co. Oil Fields Supply | - | 결정 |
D2018-1836 | buyduromineonline.com duromineonline.com | iNova Pharmaceuticals (Singapore) Pte. Limited | Daniel Constantinescu | - | 결정 |
D2018-1837 | nycifgroup.com | New York City Investment Fund, L.L.C. | Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc. | - | 결정 |
D2018-1838 | fdmag.com | The Dallas Morning News, Inc. | Perfect Privacy, LLC / Brody Cruise | - | 결정 |
D2018-1839 | lincolnnavigator.com | Ford Motor Company | Advert Online | - | 결정 |
D2018-1840 | boycottbayer.com | Bayer AG | - | - | 종료 |
D2018-1841 | bayernow.com | Bayer AG | Registration Private, Domains By Proxy, LLC. / Elizabeth Hulbert | - | 결정 |
D2018-1842 | bestiqos.com | Philip Morris Products S.A. | Liudinghong | - | 결정 |
D2018-1843 | tjarcelormittal.com | Arcelormittal S.A. | - | - | 종료 |
D2018-1844 | credit-mutuel.tech | Confederation Nationale du Credit Mutuel | Malo Corentine | - | 결정 |
D2018-1845 | catindustrie.com catmarbre.com | Caterpillar Inc. | Sara Alaoui | - | 결정 |
D2018-1846 | osramd.com | OSRAM GmbH | yue tang, tangyue | - | 결정 |
D2018-1847 | proximus.tech | PROXIMUS, NV van publiek recht | Wang Xiao Qin | - | 결정 |
D2018-1848 | starstable-hack.win | Star Stable Entertainment AB | Dawid Olszewski | - | 결정 |
D2018-1849 | temaris.com | Tenaris Connections BV | Domain Admin, HugeDomains.com | - | 결정 |
D2018-1850 | fashionphileoutlet.com | Fashionphile, LLC | - | - | 종료 |
D2018-1851 | gerbentrademark.com | Gerben Law Firm, PLLC | Whois Privacy Corp. | - | 결정 |
D2018-1852 | buyduromineonline.com | iNova Pharmaceuticals (Singapore) Pte. Limited | - | - | 종료 |
D2018-1853 | eternalfleur.com | Venus et Fleur LLC | Domains by Proxy, LLC / Amanda Wojtas | - | 결정 |
D2018-1854 | ilbm.com | International Business Machines Corporation | - | - | 종료 |
D2018-1855 | credit-mutuel-confirmation-mobile.com | Caisse Federale de Credit Mutuel Centre Est Europe Confederation Nationale du Credit Mutuel | Cherel Fichant | - | 결정 |
D2018-1856 | aex.com aex-global.com aex88.com | Euronext N.V. | Huang tian wei | - | 결정 |
D2018-1857 | elliotttmgmt.com | Elliott Management Corporation | - | - | 종료 |
D2018-1858 | gotmilkyet.com | California Milk Processor Board | Jeff Pendleton, Harvest Properties, LLC | - | 결정 |
D2018-1859 | medium-airdrop.com medium-news.com | A Medium Corporation | Protection of Private Person / Yurii Selivanov | - | 결정 |
D2018-1860 | mediurn.com | A Medium Corporation | Marat Mukhamet | - | 결정 |
D2018-1861 | dreamstine.com | Dreamstime.com, LLC | Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd | - | 결정 |
D2018-1862 | freetokenschaturbate.com | Multi Media, LLC | Registration Private, Domains By Proxy, LLC / Apetre Andrei | - | 결정 |
D2018-1863 | nmglego.com | LEGO Juris A/S (乐高博士有限公司) | Xu Yin Liang | - | 결정 |
D2018-1864 | phillpmorris.com | Philip Morris USA Inc. | - | - | 종료 |
D2018-1865 | cbdhempmeds.net | Medical Marijuana, Inc. | Domains By Proxy, LLC / Michael Wigton | - | 결정 |
D2018-1866 | divorcepaperswriter.com | Pro Se Planning, Inc. dba Divorcewriter | Registration Private, Domains By Proxy, LLC / Bogdanov Andriy | - | 결정 |
D2018-1867 | unifi-ip.com | Ubiquiti Networks, Inc. | Contact Privacy Inc. Customer 1242494592 / Paul Rolle | - | 결정 |
D2018-1868 | iqos-plus.com | Philip Morris Products S.A. | Kostas Martakis | - | 결정 |
D2018-1869 | iqos456.com | Philip Morris Products S.A. | Yang Jiang Nan | - | 결정 |
D2018-1870 | mifare.shop mifare.store | NXP B.V. | Ershov Dmitrii | - | 결정 |
D2018-1871 | mutuelcreditinvest.com | Confederation Nationale du Credit Mutuel | GARR Garderie | - | 결정 |
D2018-1872 | blackiqos.com | Philip Morris Products S.A. | - | - | 종료 |
D2018-1873 | iqosmy.net iqosmy.org | Philip Morris Products S.A. | Yuksel Kambal | - | 결정 |
D2018-1874 | pmiukraine.org | Project Management Institute, Inc. | Privacy Protect, LLC / Herr Thomas Henk | - | 결정 |
D2018-1875 | valero.vip | Valero Energy Corporation Valero Marketing and Supply Company | Lacey Larsen | - | 결정 |
D2018-1876 | bartec.com | Bartec GmbH | Privacy Administrator, Anonymize, Inc. / Brady Moritz, Brady | - | 결정 |
D2018-1877 | newclubvulcan.com onlinevlkoriginal.com playvlkoriginal.com playvlkoriginals.com vklorig.com vlkoriginalsclub.com vlkoriginals.com vulkanoriginalplay.com vulkanorigonline.com vulkanorigonline1.com | Dareos Inc. Dareos Ltd. Rizio Purchase Limited | Artur Hasamov Artur Hasamov, Private Person Gustavo Frings Moniker Privacy Services moniker.com, Moniker Online Services, LLC Oleksandr Nikolaienko Protection of Private Person | - | 결정 |
D2018-1878 | fr-robertet.com | Robertet SA | Marie Claude Holler | - | 결정 |
D2018-1879 | iqosturk.com | Philip Morris Products S.A. | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay | - | 결정 |
D2018-1880 | allybank.fun allybank.ltd allybank.online allybank.site allybank.store allybank.top | Ally Financial Inc. | Zhao Hong | - | 결정 |
D2018-1881 | capgroupco.com thecapitalgroupco.com | The Capital Group Companies, Inc. | Crystal Marie, Savoy Partners London Domains By Proxy, LLC / Savoy Partners, Savoy Partners London / Crystal Marie, Savoy Partners London | - | 결정 |
D2018-1882 | hotelpullmancayococo.com hotelpullmancayococo.website hotelsofitelagadirthalassasea-spa.website ibisbarranquilla.website lediwanrabat-mgallerybysofitel.website mercureatenea-aventura.com mercurequemadoalhoceimaresort.website novotelcasablancacitycenter.website novotelrjbotafogo.website novoteltehranairport.website pullmanmarrakechpalmeraie.website pullmanmazaganroyal-golf-spa.website sofitelagadirroyalbay.website sofitelcasablanca-tourblanche.website sofitelessaouiramogador-golfspa.website sofitelmarrakechloungeandspa.website sofitelmarrakechpalaisimperial.website sofitelrabatjardindesroses.website | Accor SA SoLuxury HMC | Orlando Andres Zunino, Sofia Project | - | 결정 |
D2018-1883 | breitlingboutique.com breitlingshop.com breitlingstore.com | Breitling SA | Manoj Kumar Alwani | - | 결정 |
D2018-1884 | dtccglobal.com | The Depository Trust & Clearing Corporation | Name Redacted | - | 결정 |
D2018-1885 | pezo.com | Pezo Tech LLC | Perfect Privacy, LLC / Mihalis Pourgouris | - | 결정 |
D2018-1886 | accentureplacement.com | Accenture Global Services Limited | Domain eRegistration | - | 결정 |
D2018-1887 | spradleyford.com | Ford Motor Company | Whois Manager, WhoIs Privacy Management Service / Brian Tyrell, Tyrrell Chevrolet Company | - | 결정 |
D2018-1888 | chep-uk.com chep-us.com | Brambles Ltd. | WhoisGuard Protected / Emimimo Steven / avoca davis | - | 결정 |
D2018-1889 | huntbrotherspizza.online | Hunt Family Properties, LLC | Larry Lee, Phoenix Success Systems | - | 결정 |
D2018-1890 | dreamstimes.com | Dreamstime.com, LLC | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd | - | 결정 |
D2018-1891 | mou-bootsoutlet.com mou-sale-online.com mousaleonline.com mou-stivali.com | Mou Limited | Domain Admin Privacy Protect, LLC (PrivacyProtect.org) Luo Yuandong, Laoyuandong Song Li Hong Sun YanQi Whois Agent, Domain Whois Privacy Protection Service | - | 결정 |
D2018-1892 | mandginvestment.com | M&G Limited | Smith Taylor | - | 결정 |
D2018-1893 | duobrii.com | Valeant Pharmaceuticals Ireland Limited | Domains By Proxy, LLC / Micro Duobri,New Micro Age | - | 결정 |
D2018-1894 | halfordsgroup.com | Halfords Limited | - | - | 종료 |
D2018-1895 | onewheel-hoverboard.com | Future Motion, Inc. | Nexperian Holding Limited / Duke Chow, Duke | - | 결정 |
D2018-1896 | socap2018.org | Social Capital Markets LLC | Domains By Proxy, LLC / victor gill | - | 결정 |
D2018-1897 | secure-gap.com | Gap (Apparel), LLC Gap (ITM) Inc. The Gap, Inc. | WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell | - | 결정 |
D2018-1898 | bouygues-services.com | Bouygues | Nom anonymisé | - | 결정 |
D2018-1899 | dreamtimes.com | Dreamstime.com, LLC | Sapphire Brands, Sapphire Brands Limited | - | 결정 |
D2018-1900 | breezula.com winlevi.com | Cassiopea S.p.A. | - | - | 종료 |
D2018-1901 | erieicedamremovalguys.com | Palumbo Services, Inc. | kyle Brink, Brink Roofing | - | 결정 |
D2018-1902 | lascal.com | Joran Lundh | PRIVACYDOTLINK Customer 2898984 / Stanley Pace | - | 결정 |
D2018-1903 | valero-usa.com | Valero Energy Corporation Valero Marketing and Supply Company | Riaat Benn | - | 결정 |
D2018-1904 | varta-automotlve.com | Johnson Controls Hybrid and Recycling GmbH | Wang Jian Hua | - | 결정 |
D2018-1905 | montar.com | Montar A/S | Domain Administrator, NameFind LLC | - | 결정 |
D2018-1906 | bosch-ua.com | Robert Bosch GmbH | Maxim SPD CHervinchuk | - | 결정 |
D2018-1907 | besteggloansreviews.com | Marlette Funding, LLC | Whois Privacy Corp | - | 결정 |
D2018-1908 | gqme.com | Advance Magazine Publishers Inc. | Robert McDonough | - | 결정 |
D2018-1909 | tmf-gronp.com | TMF Group B.V. | Contact Privacy Inc. Customer 1242811003 / The Dovetail Agency | - | 결정 |
D2018-1910 | jaegerdressessale.com | Kings Landing Limited | Name Redacted | - | 결정 |
D2018-1911 | virginluxuryhotels.com | Virgin Enterprises Limited | Zanta Consult | - | 결정 |
D2018-1912 | decathlon-sa.com | Decathlon | Bill Wang | - | 결정 |
D2018-1913 | grouperexel.com | Rexel Developpement SAS | Contact Privacy Inc. Customer 0151381151 / Jacky Durand | - | 결정 |
D2018-1914 | cic-admin.com | Crédit industriel et commercial S.A. | - | - | 종료 |
D2018-1915 | lotoeuromillions.com | S.L.E. Service aux Loteries en Europe | Super Privacy Service Ltd. c/o Dynadot | - | 결정 |
D2018-1916 | loto-euro-millions-jackpot.com | S.L.E. Service aux Loteries en Europe | Albert Rajala | - | 결정 |
D2018-1917 | euromillions-lotto.net | S.L.E. Service aux Loteries en Europe | Steve Patton, Data Download | - | 결정 |
D2018-1918 | piombo.com | 82 s.r.l. | Chris Grivas | - | 결정 |
D2018-1919 | t20worldcup.com | ICC Business Corporation FZ LLC | Shashank Sharma | - | 결정 |
D2018-1920 | foreverloveibm.com | International Business Machines Corporation | WhoisGuard Protected / Richard Anderson | - | 결정 |
D2018-1921 | ibmmonitors.net | International Business Machines Corporation | Perfect Privacy, LLC / Computer Parts, Repair & Exchange | - | 결정 |
D2018-1922 | kraftheinzcornpany.com | Kraft Heinz Foods Company | Thomas Bedford, Thomas Bedford Ltd | - | 결정 |
D2018-1923 | lincolnnavigator.org | Ford Motor Company | Customer 1242419831, Contact Privacy Inc. / Domain Privacy Service FBO Registrant. | - | 결정 |
D2018-1924 | legoland-danmark.com | LEGO Juris A/S | Admin Contact, PrivateName Services Inc. / Rey Leande | - | 결정 |
D2018-1925 | freywille.org | Frey Wille GmbH & Co. KG | Kabir S Rawat | - | 결정 |
D2018-1926 | bancointer.app | Banco Inter S.A. | Anderson Santos, leaodechacara.com | - | 결정 |
D2018-1927 | klarnabitcoin.com | Klarna Bank AB | - | - | 종료 |
D2018-1928 | klarnascam.com | Klarna Bank AB | Super Privacy Service LTD c/o Dynadot | - | 결정 |
D2018-1929 | legoclone.com | LEGO Juris A/S | Thai Dang | - | 결정 |
D2018-1930 | accenturejobsplacement.com | Accenture Global Services Limited | Domain eRegistration, Domain eRegistration | - | 결정 |
D2018-1931 | legolandstore.com | LEGO Juris A/S | 1&1 Internet Limited / Johana Juha Donado | - | 결정 |
D2018-1932 | weixinzhi.com | 腾讯控股有限公司(Tencent Holdings Limited) | Lichangzhou | - | 결정 |
D2018-1933 | kboxmobilestorage.com | K-BOX, LLC | Nicole Lewis, Marketing Cohorts | - | 결정 |
D2018-1934 | boondocker.com | Boondocker LLC | Registration Private, Domains By Proxy, LLC / Corey Boston | - | 결정 |
D2018-1935 | myh1z1.com | Daybreak Game Company LLC | Lv Guo Ping | - | 결정 |
D2018-1936 | iqoscn.net | Philip Morris Products S.A. | Jack Charls | - | 결정 |
D2018-1937 | lorealfranchise.com | L’Oréal | Contact Privacy Inc. Customer 0149511181 / Jerry Peter | - | 결정 |
D2018-1938 | carrefour.gift | Carrefour | WhoisGuard, Inc., WhoisGuard Protected / Domink Tamasi | - | 결정 |
D2018-1939 | bgiqos.com | Philip Morris Products S.A. | Hristo Aleksandrov | - | 결정 |
D2018-1940 | sandozmedikal.com sandozmedikal.xyz | Novartis AG | Domain Admin ContactID 5923835, FBS INC, Whoisprotection biz / Adem Kizilay | - | 결정 |
D2018-1941 | careerswipro.com | WIPRO Limited | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / WIPRO Technologies | - | 결정 |
D2018-1942 | sanpham3m.com | 3M COMPANY | Le Tan Hoa, Personal | - | 결정 |
D2018-1943 | pet-plan-claim-form.com | Pet Plan Ltd | On behalf of pet-plan-claim-form.com owner, Whois Privacy Service / Vadim Yasinovsky, PDFfiller inc. | - | 결정 |
D2018-1944 | groundup.com | Ground Up, Inc. | DomainMarket.com | - | 결정 |
D2018-1945 | geekway.com | Geekway, LLC | Beats | - | 결정 |
D2018-1946 | hnbwi.com | Hiawatha National Bank | Martha Coe | - | 결정 |
D2018-1947 | peltonandcrane.com | Dental Equipment LLC | Above.com Domain Privacy / Transure Enterprise Ltd | - | 결정 |
D2018-1948 | saizen.shop | Merck KGaA | Yasutaka Sakatani | - | 결정 |
D2018-1949 | banque-carefour.com banque-carefour.net | Carrefour | Zhuhai Yingxun Keji Limited / Paul Loutin, Loutin SAS | - | 결정 |
D2018-1950 | jhbqq.com | 腾讯控股有限公司(Tencent Holdings Limited) | Li Yun Zhang, Zhang Li Yun | - | 결정 |
D2018-1951 | vikingcruisesindia.com | Viking River Cruises (Bermuda) Ltd. Viking River Cruises, Inc. | Registration Private, Domains By Proxy, LLC / Kiran Bhandari | - | 결정 |
D2018-1952 | zf-motoraction-rallying.com | ZF Frledrlcbsbafen AG | - | - | 종료 |
D2018-1953 | skyscannerusa.com | Skyscanner Limited | Registration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc. | - | 결정 |
D2018-1954 | scholasticcorp.com | Scholastic Inc. | Private Registrant / Kenneth Cleary | - | 결정 |
D2018-1955 | luisstuhlberger.com | Luis Stuhlberger | Laura Yun, Antarchile S.A. | - | 결정 |
D2018-1956 | instagrambadge.com | Instagram, LLC | InstagramBadge, LLC | - | 결정 |
D2018-1957 | groupon.space | Groupon, Inc. | Whoisguard Protected, Whoisguard, Inc. / Lim Chia Wah | - | 결정 |
D2018-1958 | legally.com | Legally Co | Domain Administrator, Namefind LLC | - | 결정 |
D2018-1959 | amegybankl.com | ZB, N.A. | Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico | - | 결정 |
D2018-1960 | badgleymischkaswim.com badgleymischkaswimwear.com | Badgley Mischka, LLC | Ariel Fein | - | 결정 |
D2018-1961 | ibinder.net | iBinder AB | - | - | 종료 |
D2018-1962 | authenticjordansair.com | Nike Innovate C.V. | Li Jian Fan | - | 결정 |
D2018-1963 | weixinxinyong.com | 腾讯控股有限公司(Tencent Holdings Limited) | - | - | 종료 |
D2018-1964 | weixinjingpindian.com weixinzhengxin.com | 腾讯控股有限公司(Tencent Holdings Limited) | Shixue Lian | - | 결정 |
D2018-1965 | nintendotencent.com | 腾讯控股有限公司(Tencent Holdings Limited) | Yuan Bing | - | 결정 |
D2018-1966 | blancpain.store breguet.store | Blancpain SA Montres Breguet SA | Privacydotlink Customer 3450628 Privacydotlink Customer 3450653 / George Friar | - | 결정 |
D2018-1967 | thegapcafebar.com | Gap (Apparel), LLC Gap (ITM) Inc. The Gap, Inc. | Domain Whois Privacy Service / Carole Posey | - | 결정 |
D2018-1968 | legobrazil.com legoca.com legoengland.com legoeu.com legomexico.com legosouthkorea.com legothailand.com legovipclub.com | LEGO Juris A/S | Marco AntonioServin lugo, Legomexico llc Name Redacted Name Redacted Name Redacted Sagar Sunar, legokorea.llc Wenben Zhou | - | 결정 |
D2018-1969 | wechatcredit.com | 腾讯控股有限公司(Tencent Holdings Limited) | Pan She Ling | - | 결정 |
D2018-1970 | banquecic.com | Crédit Industriel et Commercial S.A. | - | - | 종료 |
D2018-1971 | iqossigarasitesi.com | Philip Morris Products S.A. | Kadir \u015eayir, Kadir | - | 결정 |
D2018-1972 | iqos-vietnam.com | Philip Morris Products S.A. | Nguyen Minh Hoang | - | 결정 |
D2018-1973 | shellcorporate.com | Shell Brands International AG | Jimmy Luis | - | 결정 |
D2018-1974 | arcelormittaliran.com | Arcelormittal (SA) | مسعود ثقفي | - | 결정 |
D2018-1975 | haribo-de.com | HARIBO GmbH & Co. KG | Whois Agent, Domain Protection Services, Inc. / louane Severins | - | 결정 |
D2018-1976 | arcelormittal-mexico.com | ArcelorMittal S.A. | Ruben Gomez | - | 결정 |
D2018-1977 | sticks-heets.com | Philip Morris Products S.A. | Whois privacy protection service, Internet Invest, Ltd. dba Imena.ua / Aleksandr Sidorov | - | 결정 |
D2018-1978 | dealmaker.com | DealMaker, LLC | Brian Dillon-Ferris | - | 결정 |
D2018-1979 | virgin-hyperloopone.com virginneckerisland.com virginushotels.com virginworldunite.com | Virgin Enterprises Limited | Abdab Consult | - | 결정 |
D2018-1980 | potterybrn-shopping.world | Williams-Sonoma, Inc. | - | - | 종료 |
D2018-1981 | livlabs.com livlabsnow.com | LivOn Laboratories, Inc | Mike Kearl | - | 결정 |
D2018-1982 | advancefinance247.com af247loan.com af247offer.com | Harpeth Financial Services LLC, d/b/a Advance Financial 24/7 | Domains by Proxy, LLC / Nirut Naehitumrong / Phensri Thadkaew | - | 결정 |
D2018-1983 | af247online.com | Harpeth Financial Services LLC, d/b/a Advance Financial 24/7 | Domain Admin, Whois Privacy Corp. | - | 결정 |
D2018-1984 | aeg-remont.xyz | AB Electrolux | Petr Demidov | - | 결정 |
D2018-1985 | carrefoursecure.com | Carrefour | Contact Privacy Inc. Customer 0151522304 / lucas montanaro | - | 결정 |
D2018-1986 | airfrance-com.win airfrancewin.win | Société Air France | Domain Administrator, See PrivacyGuardian.org / Steve David, Kamran Khan, Muhammad Faisal | - | 결정 |
D2018-1987 | skyscannerflight.com | Skyscanner Limited | Domain May Be for Sale, Check Afternic.com Domain Admin, Domain Registries Foundation | - | 결정 |
D2018-1988 | creditmutuel.expert creditmutuel.shop | Confédération nationale du Crédit Mutuel | Catherine Forali | - | 결정 |
D2018-1989 | gordonblucatering.com | Le Cordon Bleu International B.V. | Gordon Blu Spolka Z Ograniczona Odpowiedzialnoscia | - | 결정 |
D2018-1990 | cordonbleuonline.com | Le Cordon Bleu International B.V. | Carla Rodrigues | - | 결정 |
D2018-1991 | arpenaz-quechua.com | Decathlon | Pavel Ostapenko | - | 결정 |
D2018-1992 | zipreccruiter.com ziprecruiteer.com ziprecruiterr.com zipreecruiter.com ziprrecruiter.com ziprwcruiter.com | ZipRecruiter, Inc. | Cyber Domain Services Private Limited Laksh Internet Solutions Private Limited Postoffice Mailing Solutions Pvt. Ltd SMVS Consultancy Private Limited Tech Domain Services Private Limited Web Master Internet Services Private Limited | - | 결정 |
D2018-1993 | camfrog.vip | Camshare, Inc. | - | - | 종료 |
D2018-1994 | accenturerecruitment.com | Accenture Global Services Limited | Domain eRegistration | - | 결정 |
D2018-1995 | fusion3.com | Fusion3 Design, LLC | Fusion3 Inc. f/k/a TradeMark Management | - | 결정 |
D2018-1996 | rakuten.app | Rakuten, Inc. | Registration Private, Domains By Proxy, LLC / Jack Lim | - | 결정 |
D2018-1997 | astonmartinjp.com | Aston Martin Lagonda Limited | WhoisGuard Protected, WhoisGuard, Inc. / Sean Sterling | - | 결정 |
D2018-1998 | turboxtax.com | Intuit Inc. | Privacydotlink Customer 3671581 / JASPER DEVELOPMENTS PTY LTD | - | 결정 |
D2018-1999 | yurbotax.com | Intuit Inc. | Privacy.co.com, Savvy Investments, LLC Privacy ID# 1130202 | - | 결정 |