WIPO UDRP Domain Name Decisions

Decisions: D2018-1800 - D2018-1999

For further details concerning a particular Administrative Panel decision, please contact us.

Last updated: Oct 21, 2018

Case Number Complainant Respondent Domain Name(s) Decision
D2018-1800Beymen Maǧazacılık Anonim Şirketi-beymenyapi.comTerminated
D2018-1801Dunder Limited-dunderfun.comTerminated
D2018-1802Belfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkersbelfius.appTransfer
D2018-1804Rockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Millsrockefellerqroup.comTransfer
D2018-1805American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Laylaamericanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
Transfer
D2018-1807LinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metricsbuylinkedinfollowers.comTransfer
D2018-1808Asianet Satellite Communications LimitedFuture Media Architects Inc.asianet.netComplaint denied
D2018-1809InterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltdgoindigo.comTransfer
D2018-1810Navasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko 1xbet.dateTransfer
D2018-1811Crédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexiscic-mon-compte.reviewTransfer
D2018-1812Tang Frerestang frerestangfreres.onlineTransfer
D2018-1813Alain Afflelou Franchiseur-afflelou3d.comTerminated
D2018-1815HID Global CorporationJohn Makinwahidqlobal.comTransfer
D2018-1816Childrens Outlet LtdIan Davidson, Childrensalon Ltdchildrensoutlet.comTransfer
D2018-1817ArcelorMittal (SA)zhou zhou, zhou zhouarcelormittal.topTransfer
D2018-1819Mr BricolageWhoisGuard, Inc. / Alexandre Noffymr-bricolage.onlineTransfer
D2018-1821Laboratoires Thea-blephacleanse.comTerminated
D2018-1823AB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.zanussi.expertTransfer
D2018-1824Inter-Continental Hotels Corporationnibah perfect fondikumintercontinentalhotelaustin.comTransfer
D2018-1825Expensify, Inc.-expensifysupport.comTerminated
D2018-1826Roland Szegi-airvape.comTerminated
D2018-1827Oanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatteroandaxmtrade.comTransfer
D2018-1828iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.buy-duromine.com
cheapduromine.com
Transfer
D2018-1829SAP SESwarup Choudhurisaphanatutorial.comTransfer
D2018-1830Allianz SEInnokentiy Maskileysonallianz.travelTransfer
D2018-1832Boyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boynersboynerler.comComplaint denied
D2018-1834BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
Transfer
D2018-1836iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescubuyduromineonline.com
duromineonline.com
Transfer
D2018-1837New York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.nycifgroup.comTransfer
D2018-1838The Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise fdmag.comTransfer
D2018-1839Ford Motor CompanyAdvert Onlinelincolnnavigator.comTransfer
D2018-1840Bayer AG-boycottbayer.comTerminated
D2018-1842Philip Morris Products S.A.Liudinghongbestiqos.comTransfer
D2018-1843Arcelormittal S.A.-tjarcelormittal.comTerminated
D2018-1846OSRAM GmbHyue tang, tangyueosramd.comTransfer
D2018-1847PROXIMUS, NV van publiek rechtWang Xiao Qin proximus.techTransfer
D2018-1848Star Stable Entertainment ABDawid Olszewskistarstable-hack.winTransfer
D2018-1850Fashionphile, LLC-fashionphileoutlet.comTerminated
D2018-1851Gerben Law Firm, PLLCWhois Privacy Corp.gerbentrademark.comTransfer
D2018-1852iNova Pharmaceuticals (Singapore) Pte. Limited-buyduromineonline.comCase active
D2018-1854International Business Machines Corporation-ilbm.comTerminated
D2018-1855Caisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichantcredit-mutuel-confirmation-mobile.comTransfer
D2018-1860A Medium CorporationMarat Mukhametmediurn.comTransfer
D2018-1861Dreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltddreamstine.comTransfer
D2018-1863LEGO Juris A/S (乐高博士有限公司)Xu Yin Liangnmglego.comTransfer
D2018-1864Philip Morris USA Inc.-phillpmorris.comTerminated
D2018-1867Ubiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolleunifi-ip.comTransfer
D2018-1868Philip Morris Products S.A.Kostas Martakisiqos-plus.comTransfer
D2018-1869Philip Morris Products S.A.Yang Jiang Naniqos456.comTransfer
D2018-1870NXP B.V.Ershov Dmitriimifare.shop
mifare.store
Transfer
D2018-1872Philip Morris Products S.A.-blackiqos.comTerminated
D2018-1873Philip Morris Products S.A.Yuksel Kambaliqosmy.net
iqosmy.org
Transfer
D2018-1876Bartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Bradybartec.comTransfer
D2018-1879Philip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalayiqosturk.comTransfer
D2018-1882Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Projecthotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Transfer
D2018-1883Breitling SAManoj Kumar Alwanibreitlingboutique.com
breitlingshop.com
breitlingstore.com
Transfer
D2018-1884The Depository Trust & Clearing CorporationName Redacteddtccglobal.comTransfer
D2018-1889Hunt Family Properties, LLCLarry Lee, Phoenix Success Systemshuntbrotherspizza.onlineTransfer
D2018-1890Dreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltddreamstimes.comTransfer
D2018-1892M&G LimitedSmith Taylormandginvestment.comTransfer
D2018-1894Halfords Limited-halfordsgroup.comTerminated
D2018-1897Gap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell secure-gap.comTransfer
D2018-1900Cassiopea S.p.A.-breezula.com
winlevi.com
Terminated
D2018-1905Montar A/SDomain Administrator, NameFind LLCmontar.comComplaint denied
D2018-1911Virgin Enterprises LimitedZanta Consultvirginluxuryhotels.comTransfer
D2018-1913Rexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durandgrouperexel.comTransfer
D2018-1914Crédit industriel et commercial S.A.-cic-admin.comTerminated
D2018-191882 s.r.l.Chris Grivaspiombo.comComplaint denied
D2018-1920International Business Machines CorporationWhoisGuard Protected / Richard Andersonforeverloveibm.comTransfer
D2018-1921International Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchangeibmmonitors.netTransfer
D2018-1922Kraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltdkraftheinzcornpany.comTransfer
D2018-1927Klarna Bank AB-klarnabitcoin.comTransfer
D2018-1932腾讯控股有限公司(Tencent Holdings Limited)Lichangzhouweixinzhi.comTransfer
D2018-1937L’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peterlorealfranchise.comTransfer
D2018-1947Dental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltdpeltonandcrane.comTransfer
D2018-1950腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yunjhbqq.comCase active
D2018-1953Skyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.skyscannerusa.comTransfer
D2018-1960Badgley Mischka, LLCAriel Feinbadgleymischkaswim.com
badgleymischkaswimwear.com
Transfer
D2018-1965腾讯控股有限公司(Tencent Holdings Limited)Yuan Bingnintendotencent.comTransfer
D2018-1966Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
blancpain.store
breguet.store
Transfer
D2018-1970Crédit Industriel et Commercial S.A.-banquecic.comTerminated
D2018-1980Williams-Sonoma, Inc.-potterybrn-shopping.worldTerminated