All Cases: D2018-1800 - D2018-1999

Last updated: Oct 24, 2018

Case Number Domain Name(s) Complainant Respondent Commencement Date Case Status
D2018-1800beymenyapi.comBeymen Maǧazacılık Anonim Şirketi--Terminated
D2018-1801dunderfun.comDunder Limited--Terminated
D2018-1802belfius.appBelfius Banque S.A./ Belfius Bank NVContact Privacy Inc. Customer 1242626048 / Maarten Bekkers-Decided
D2018-1803easybreath.websiteProjectClub-August 17, 2018Pending
D2018-1804rockefellerqroup.comRockefeller Group International, Inc.Registration Private, Domains By Proxy, LLC / Jason Mills-Decided
D2018-1805americanhomeshield.app
merrymaids.app
servicemaster.app
terminix.app
American Home Shield Corporation
ServiceMaster Brands, L.L.C.
The Terminix International Company Limited Partnership
Contact Privacy Inc. Customer 1242671357 / Contact Privacy Inc. Customer 1242671322 / Contact Privacy Inc. Customer 1242671309 / Contact Privacy Inc. Customer 1242671356 / Nate Brown, Luxury & Layla-Decided
D2018-1806chatur2018.comMulti Media, LLC-August 23, 2018Pending
D2018-1807buylinkedinfollowers.comLinkedIn CorporationRegistration Private, Domains By Proxy, LLC / Sathishkumar Varatharajan, Kudo Metrics-Decided
D2018-1808asianet.netAsianet Satellite Communications LimitedFuture Media Architects Inc.-Decided
D2018-1809goindigo.comInterGlobe Aviation LimitedDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-18101xbet.dateNavasard LimitedWhoisGuard Protected, WhoisGuard Inc. / Dmytro Susidko -Decided
D2018-1811cic-mon-compte.reviewCrédit Industriel et CommercialWhoisGuard, Inc. / Thierry Alexis-Decided
D2018-1812tangfreres.onlineTang Frerestang freres-Decided
D2018-1813afflelou3d.comAlain Afflelou Franchiseur--Terminated
D2018-1814kikotechnology.comKiko Technology Limited-August 30, 2018Pending
D2018-1815hidqlobal.comHID Global CorporationJohn Makinwa-Decided
D2018-1816childrensoutlet.comChildrens Outlet LtdIan Davidson, Childrensalon Ltd-Decided
D2018-1817arcelormittal.topArcelorMittal (SA)zhou zhou, zhou zhou-Decided
D2018-1818creditmutuel.companyConfederation Nationale Du Credit Mutuel-September 10, 2018Pending
D2018-1819mr-bricolage.onlineMr BricolageWhoisGuard, Inc. / Alexandre Noffy-Decided
D2018-1820zanussi.online
zanussi.site
AB Electrolux--Suspended
D2018-1821blephacleanse.comLaboratoires Thea--Terminated
D2018-1822zanussi.clickAB Electrolux-August 16, 2018Pending
D2018-1823zanussi.expertAB ElectroluxPrivacy protection service - whoisproxy.ru / Zoom ltd.-Decided
D2018-1824intercontinentalhotelaustin.comInter-Continental Hotels Corporationnibah perfect fondikum-Decided
D2018-1825expensifysupport.comExpensify, Inc.--Terminated
D2018-1826airvape.comRoland Szegi--Terminated
D2018-1827oandaxmtrade.comOanda CorporationOANDAXMTRADE.COM c/o WhoisGuard, Inc., WhoisGuard Protected / Joseph Blatter-Decided
D2018-1828buy-duromine.com
cheapduromine.com
iNova Pharmaceuticals (Singapore) Pte. LimitedWhois Privacy Corp.-Decided
D2018-1829saphanatutorial.comSAP SESwarup Choudhuri-Decided
D2018-1830allianz.travelAllianz SEInnokentiy Maskileyson-Decided
D2018-1831brightonseagulls.club
brightonseagulls.com
brightonseagulls.info
brightonseagulls.net
The Brighton and Hove Albion Football Club Limited-August 20, 2018Pending
D2018-1832boynerler.comBoyner Büyük Mağazacılık Anonim ŞirketiAli Boyner, Boyners-Decided
D2018-1833implantcast.comImplantcast GmbH-September 11, 2018Pending
D2018-1834buscemi-online.com
buscemi-outlet.com
buscemi-sale.com
BUSCEMI LLCLao Yuan Dong
Whois Agent, Whois Privacy Protection Service / Chen WenTing
Xinnet Whois Privacy Pro Service / Sun Yanqi
-Decided
D2018-1835higeen.comHouseholds & Toiletries Manufacturing Co. Ltd.-August 13, 2018Pending
D2018-1836buyduromineonline.com
duromineonline.com
iNova Pharmaceuticals (Singapore) Pte. LimitedDaniel Constantinescu-Decided
D2018-1837nycifgroup.comNew York City Investment Fund, L.L.C.Markus Pedrigal / WhoisGuard Protected, WhoisGuard, Inc.-Decided
D2018-1838fdmag.comThe Dallas Morning News, Inc.Perfect Privacy, LLC / Brody Cruise -Decided
D2018-1839lincolnnavigator.comFord Motor CompanyAdvert Online-Decided
D2018-1840boycottbayer.comBayer AG--Terminated
D2018-1841bayernow.comBayer AG-September 12, 2018Pending
D2018-1842bestiqos.comPhilip Morris Products S.A.Liudinghong-Decided
D2018-1843tjarcelormittal.comArcelormittal S.A.--Terminated
D2018-1844credit-mutuel.techConfederation Nationale du Credit Mutuel-August 24, 2018Pending
D2018-1845catindustrie.com
catmarbre.com
Caterpillar Inc.-September 11, 2018Pending
D2018-1846osramd.comOSRAM GmbHyue tang, tangyue-Decided
D2018-1847proximus.techPROXIMUS, NV van publiek rechtWang Xiao Qin -Decided
D2018-1848starstable-hack.winStar Stable Entertainment ABDawid Olszewski-Decided
D2018-1849temaris.comTenaris Connections BV-August 21, 2018Pending
D2018-1850fashionphileoutlet.comFashionphile, LLC--Terminated
D2018-1851gerbentrademark.comGerben Law Firm, PLLCWhois Privacy Corp.-Decided
D2018-1852buyduromineonline.comiNova Pharmaceuticals (Singapore) Pte. Limited--Terminated
D2018-1853eternalfleur.comVenus et Fleur LLC-August 20, 2018Pending
D2018-1854ilbm.comInternational Business Machines Corporation--Terminated
D2018-1855credit-mutuel-confirmation-mobile.comCaisse Federale de Credit Mutuel Centre Est Europe
Confederation Nationale du Credit Mutuel
Cherel Fichant-Decided
D2018-1856aex.com
aex-global.com
aex88.com
Euronext N.V.-August 20, 2018Pending
D2018-1857elliotttmgmt.comElliott Management Corporation--Suspended
D2018-1858gotmilkyet.comCalifornia Milk Processor Board-August 20, 2018Decided
D2018-1859medium-airdrop.com
medium-news.com
A Medium Corporation-October 17, 2018Pending
D2018-1860mediurn.comA Medium CorporationMarat Mukhamet-Decided
D2018-1861dreamstine.comDreamstime.com, LLCDomain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-1862freetokenschaturbate.comMulti Media, LLC-August 30, 2018Pending
D2018-1863nmglego.comLEGO Juris A/S (乐高博士有限公司)Xu Yin Liang-Decided
D2018-1864phillpmorris.comPhilip Morris USA Inc.--Terminated
D2018-1865cbdhempmeds.netMedical Marijuana, Inc.-August 24, 2018Pending
D2018-1866divorcepaperswriter.comPro Se Planning, Inc. dba Divorcewriter-September 4, 2018Pending
D2018-1867unifi-ip.comUbiquiti Networks, Inc.Contact Privacy Inc. Customer 1242494592 / Paul Rolle-Decided
D2018-1868iqos-plus.comPhilip Morris Products S.A.Kostas Martakis-Decided
D2018-1869iqos456.comPhilip Morris Products S.A.Yang Jiang Nan-Decided
D2018-1870mifare.shop
mifare.store
NXP B.V.Ershov Dmitrii-Decided
D2018-1871mutuelcreditinvest.comConfederation Nationale du Credit Mutuel-August 27, 2018Pending
D2018-1872blackiqos.comPhilip Morris Products S.A.--Terminated
D2018-1873iqosmy.net
iqosmy.org
Philip Morris Products S.A.Yuksel Kambal-Decided
D2018-1874pmiukraine.orgProject Management Institute, Inc.-September 7, 2018Pending
D2018-1875valero.vipValero Energy Corporation
Valero Marketing and Supply Company
-August 30, 2018Pending
D2018-1876bartec.comBartec GmbHPrivacy Administrator, Anonymize, Inc. / Brady Moritz, Brady-Decided
D2018-1877newclubvulcan.com
onlinevlkoriginal.com
playvlkoriginal.com
playvlkoriginals.com
vklorig.com
vlkoriginalsclub.com
vlkoriginals.com
vulkanoriginalplay.com
vulkanorigonline.com
vulkanorigonline1.com
Dareos Inc.
Dareos Ltd.
Rizio Purchase Limited
-September 7, 2018Pending
D2018-1878fr-robertet.comRobertet SA-August 29, 2018Pending
D2018-1879iqosturk.comPhilip Morris Products S.A.Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Cihan Atalay-Decided
D2018-1880allybank.fun
allybank.ltd
allybank.online
allybank.site
allybank.store
allybank.top
Ally Financial Inc.--Suspended
D2018-1881capgroupco.com
thecapitalgroupco.com
The Capital Group Companies, Inc.-September 7, 2018Pending
D2018-1882hotelpullmancayococo.com
hotelpullmancayococo.website
hotelsofitelagadirthalassasea-spa.website
ibisbarranquilla.website
lediwanrabat-mgallerybysofitel.website
mercureatenea-aventura.com
mercurequemadoalhoceimaresort.website
novotelcasablancacitycenter.website
novotelrjbotafogo.website
novoteltehranairport.website
pullmanmarrakechpalmeraie.website
pullmanmazaganroyal-golf-spa.website
sofitelagadirroyalbay.website
sofitelcasablanca-tourblanche.website
sofitelessaouiramogador-golfspa.website
sofitelmarrakechloungeandspa.website
sofitelmarrakechpalaisimperial.website
sofitelrabatjardindesroses.website
Accor SA
SoLuxury HMC
Orlando Andres Zunino, Sofia Project-Decided
D2018-1883breitlingboutique.com
breitlingshop.com
breitlingstore.com
Breitling SAManoj Kumar Alwani-Decided
D2018-1884dtccglobal.comThe Depository Trust & Clearing CorporationName Redacted-Decided
D2018-1885pezo.comPezo Tech LLC-August 30, 2018Pending
D2018-1886accentureplacement.comAccenture Global Services Limited-August 27, 2018Decided
D2018-1887spradleyford.comFord Motor Company-August 27, 2018Pending
D2018-1888chep-uk.com
chep-us.com
Brambles Ltd.-August 31, 2018Pending
D2018-1889huntbrotherspizza.onlineHunt Family Properties, LLCLarry Lee, Phoenix Success Systems-Decided
D2018-1890dreamstimes.comDreamstime.com, LLCDomain Admin, Privacy Protect, LLC (PrivacyProtect.org) / Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd-Decided
D2018-1891mou-bootsoutlet.com
mou-sale-online.com
mousaleonline.com
mou-stivali.com
Mou Limited-September 3, 2018Pending
D2018-1892mandginvestment.comM&G LimitedSmith Taylor-Decided
D2018-1893duobrii.comValeant Pharmaceuticals Ireland Limited-August 29, 2018Pending
D2018-1894halfordsgroup.comHalfords Limited--Terminated
D2018-1895onewheel-hoverboard.comFuture Motion, Inc.-August 28, 2018Pending
D2018-1896socap2018.orgSocial Capital Markets LLC-September 10, 2018Pending
D2018-1897secure-gap.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell -Decided
D2018-1898bouygues-services.comBouygues-September 13, 2018Pending
D2018-1899dreamtimes.comDreamstime.com, LLC-September 12, 2018Pending
D2018-1900breezula.com
winlevi.com
Cassiopea S.p.A.--Terminated
D2018-1901erieicedamremovalguys.comPalumbo Services, Inc.-September 14, 2018Pending
D2018-1902lascal.comJoran Lundh-September 11, 2018Pending
D2018-1903valero-usa.comValero Energy Corporation
Valero Marketing and Supply Company
-August 31, 2018Pending
D2018-1904varta-automotlve.comJohnson Controls Hybrid and Recycling GmbH-September 10, 2018Pending
D2018-1905montar.comMontar A/SDomain Administrator, NameFind LLC-Decided
D2018-1906bosch-ua.comRobert Bosch GmbH-August 30, 2018Pending
D2018-1907besteggloansreviews.comMarlette Funding, LLC-August 30, 2018Pending
D2018-1908gqme.comAdvance Magazine Publishers Inc.-August 31, 2018Pending
D2018-1909tmf-gronp.comTMF Group B.V.-August 27, 2018Pending
D2018-1910jaegerdressessale.comKings Landing Limited-September 10, 2018Pending
D2018-1911virginluxuryhotels.comVirgin Enterprises LimitedZanta Consult-Decided
D2018-1912decathlon-sa.comDecathlon-August 27, 2018Decided
D2018-1913grouperexel.comRexel Developpement SASContact Privacy Inc. Customer 0151381151 / Jacky Durand-Decided
D2018-1914cic-admin.comCrédit industriel et commercial S.A.--Terminated
D2018-1915lotoeuromillions.comS.L.E. Service aux Loteries en Europe-August 29, 2018Pending
D2018-1916loto-euro-millions-jackpot.comS.L.E. Service aux Loteries en Europe-September 10, 2018Pending
D2018-1917euromillions-lotto.netS.L.E. Service aux Loteries en Europe-August 30, 2018Decided
D2018-1918piombo.com82 s.r.l.Chris Grivas-Decided
D2018-1919t20worldcup.comICC Business Corporation FZ LLC-August 30, 2018Pending
D2018-1920foreverloveibm.comInternational Business Machines CorporationWhoisGuard Protected / Richard Anderson-Decided
D2018-1921ibmmonitors.netInternational Business Machines CorporationPerfect Privacy, LLC / Computer Parts, Repair & Exchange-Decided
D2018-1922kraftheinzcornpany.comKraft Heinz Foods CompanyThomas Bedford, Thomas Bedford Ltd-Decided
D2018-1923lincolnnavigator.orgFord Motor Company-August 31, 2018Pending
D2018-1924legoland-danmark.comLEGO Juris A/S-September 10, 2018Pending
D2018-1925freywille.orgFrey Wille GmbH & Co. KG-September 4, 2018Pending
D2018-1926bancointer.appBanco Inter S.A.-August 30, 2018Pending
D2018-1927klarnabitcoin.comKlarna Bank AB--Terminated
D2018-1928klarnascam.comKlarna Bank AB-September 5, 2018Pending
D2018-1929legoclone.comLEGO Juris A/S-August 31, 2018Pending
D2018-1930accenturejobsplacement.comAccenture Global Services Limited-September 3, 2018Decided
D2018-1931legolandstore.comLEGO Juris A/S-September 4, 2018Decided
D2018-1932weixinzhi.com腾讯控股有限公司(Tencent Holdings Limited)Lichangzhou-Decided
D2018-1933kboxmobilestorage.comK-BOX, LLC-August 31, 2018Pending
D2018-1934boondocker.comBoondocker LLC-September 7, 2018Pending
D2018-1935myh1z1.comDaybreak Game Company LLC-October 18, 2018Pending
D2018-1936iqoscn.netPhilip Morris Products S.A.-September 3, 2018Pending
D2018-1937lorealfranchise.comL’OréalContact Privacy Inc. Customer 0149511181 / Jerry Peter-Decided
D2018-1938carrefour.giftCarrefour-September 3, 2018Pending
D2018-1939bgiqos.comPhilip Morris Products S.A.-September 4, 2018Pending
D2018-1940sandozmedikal.com
sandozmedikal.xyz
Novartis AG-September 3, 2018Pending
D2018-1941careerswipro.comWIPRO Limited-September 3, 2018Pending
D2018-1942sanpham3m.com3M COMPANY-September 24, 2018Pending
D2018-1943pet-plan-claim-form.comPet Plan Ltd-September 10, 2018Pending
D2018-1944groundup.comGround Up, Inc.-September 7, 2018Pending
D2018-1945geekway.comGeekway, LLC-September 18, 2018Pending
D2018-1946hnbwi.comHiawatha National Bank-September 4, 2018Pending
D2018-1947peltonandcrane.comDental Equipment LLCAbove.com Domain Privacy / Transure Enterprise Ltd-Decided
D2018-1948saizen.shopMerck KGaA-September 20, 2018Pending
D2018-1949banque-carefour.com
banque-carefour.net
Carrefour-September 14, 2018Pending
D2018-1950jhbqq.com腾讯控股有限公司(Tencent Holdings Limited)Li Yun Zhang, Zhang Li Yun-Decided
D2018-1951vikingcruisesindia.comViking River Cruises (Bermuda) Ltd.
Viking River Cruises, Inc.
-September 13, 2018Pending
D2018-1952zf-motoraction-rallying.comZF Frledrlcbsbafen AG--Suspended
D2018-1953skyscannerusa.comSkyscanner LimitedRegistration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc.-Decided
D2018-1954scholasticcorp.comScholastic Inc.-September 28, 2018Pending
D2018-1955luisstuhlberger.comLuis Stuhlberger-September 13, 2018Pending
D2018-1956instagrambadge.comInstagram, LLC-September 17, 2018Pending
D2018-1957groupon.spaceGroupon, Inc.-September 24, 2018Pending
D2018-1958legally.comLegally Co-August 31, 2018Pending
D2018-1959amegybankl.comZB, N.A.-September 11, 2018Pending
D2018-1960badgleymischkaswim.com
badgleymischkaswimwear.com
Badgley Mischka, LLCAriel Fein-Decided
D2018-1961ibinder.netiBinder AB--Suspended
D2018-1962authenticjordansair.comNike Innovate C.V.-September 7, 2018Pending
D2018-1963weixinxinyong.com腾讯控股有限公司(Tencent Holdings Limited)-September 10, 2018Pending
D2018-1964weixinjingpindian.com
weixinzhengxin.com
腾讯控股有限公司(Tencent Holdings Limited)-September 11, 2018Pending
D2018-1965nintendotencent.com腾讯控股有限公司(Tencent Holdings Limited)Yuan Bing-Decided
D2018-1966blancpain.store
breguet.store
Blancpain SA
Montres Breguet SA
Privacydotlink Customer 3450628
Privacydotlink Customer 3450653 / George Friar
-Decided
D2018-1967thegapcafebar.comGap (Apparel), LLC
Gap (ITM) Inc.
The Gap, Inc.
-October 11, 2018Pending
D2018-1968legobrazil.com
legoca.com
legoengland.com
legoeu.com
legomexico.com
legosouthkorea.com
legothailand.com
legovipclub.com
LEGO Juris A/S-September 5, 2018Pending
D2018-1969wechatcredit.com腾讯控股有限公司(Tencent Holdings Limited)-September 11, 2018Pending
D2018-1970banquecic.comCrédit Industriel et Commercial S.A.--Terminated
D2018-1971iqossigarasitesi.comPhilip Morris Products S.A.-September 12, 2018Pending
D2018-1972iqos-vietnam.comPhilip Morris Products S.A.-September 17, 2018Pending
D2018-1973shellcorporate.comShell Brands International AG-September 12, 2018Pending
D2018-1974arcelormittaliran.comArcelormittal (SA)-September 11, 2018Pending
D2018-1975haribo-de.comHARIBO GmbH & Co. KG-September 24, 2018Pending
D2018-1976arcelormittal-mexico.comArcelorMittal S.A.-September 5, 2018Pending
D2018-1977sticks-heets.comPhilip Morris Products S.A.-September 14, 2018Pending
D2018-1978dealmaker.comDealMaker, LLC-September 13, 2018Pending
D2018-1979virgin-hyperloopone.com
virginneckerisland.com
virginushotels.com
virginworldunite.com
Virgin Enterprises Limited-September 10, 2018Pending
D2018-1980potterybrn-shopping.worldWilliams-Sonoma, Inc.--Terminated
D2018-1981livlabs.com
livlabsnow.com
LivOn Laboratories, Inc-September 7, 2018Pending
D2018-1982advancefinance247.com
af247loan.com
af247offer.com
Harpeth Financial Services LLC, d/b/a Advance Financial 24/7-September 17, 2018Pending
D2018-1983af247online.comHarpeth Financial Services LLC, d/b/a Advance Financial 24/7-September 10, 2018Pending
D2018-1984aeg-remont.xyzAB Electrolux-September 20, 2018Pending
D2018-1985carrefoursecure.comCarrefour-September 14, 2018Pending
D2018-1986airfrance-com.win
airfrancewin.win
Société Air France-September 18, 2018Pending
D2018-1987skyscannerflight.comSkyscanner Limited-September 7, 2018Pending
D2018-1988creditmutuel.expert
creditmutuel.shop
Confédération nationale du crédit mutuel-September 11, 2018Pending
D2018-1989gordonblucatering.comLe Cordon Bleu International B.V.-September 5, 2018Pending
D2018-1990cordonbleuonline.comLe Cordon Bleu International B.V.-September 7, 2018Pending
D2018-1991arpenaz-quechua.comDecathlon-September 19, 2018Pending
D2018-1992zipreccruiter.com
ziprecruiteer.com
ziprecruiterr.com
zipreecruiter.com
ziprrecruiter.com
ziprwcruiter.com
ZipRecruiter, Inc.-September 11, 2018Pending
D2018-1993camfrog.vipCamshare, Inc.--Suspended
D2018-1994accenturerecruitment.comAccenture Global Services Limited-September 11, 2018Pending
D2018-1995fusion3.comFusion3 Design, LLC-September 19, 2018Pending
D2018-1996rakuten.appRakuten, Inc.-September 12, 2018Pending
D2018-1997astonmartinjp.comAston Martin Lagonda Limited--Suspended
D2018-1998turboxtax.comIntuit Inc.-September 13, 2018Pending
D2018-1999yurbotax.comIntuit Inc.-September 7, 2018Pending